BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0129 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 231 2e-61 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 229 1e-60 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 1.3 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 1.3 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.2 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 2.9 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 2.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.0 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 28 5.0 At1g18670.1 68414.m02330 protein kinase family protein contains ... 28 5.0 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.7 At5g01010.1 68418.m00001 expressed protein 28 6.7 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 6.7 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 27 8.8 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 8.8 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 231 bits (566), Expect = 2e-61 Identities = 113/209 (54%), Positives = 137/209 (65%), Gaps = 2/209 (0%) Frame = +3 Query: 66 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 239 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 240 KEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXX 419 K+AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 61 KKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRV 120 Query: 420 XXXXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLK 599 ARGH IE +PE+PLVV+D + + KT A+ L+++ Sbjct: 121 NVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIG 180 Query: 600 AWSDILKVYKSQRLRAGKGKMRNRRRIQR 686 A+ D K S +R GKGKMRNRR I R Sbjct: 181 AYDDAEKAKNSIGIRPGKGKMRNRRYISR 209 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 229 bits (561), Expect = 1e-60 Identities = 113/206 (54%), Positives = 133/206 (64%), Gaps = 2/206 (0%) Frame = +3 Query: 75 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 248 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 249 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXX 428 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 124 Query: 429 XXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWS 608 ARGH IE +PE+PLVV+D + + KT A+ L+++ A+ Sbjct: 125 MKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYD 184 Query: 609 DILKVYKSQRLRAGKGKMRNRRRIQR 686 D K S +R GKGKMRNRR I R Sbjct: 185 DAEKAKNSIGIRPGKGKMRNRRYISR 210 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 Query: 365 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCCYRRPSARSG*RTHY*KDSRASLGCSRQ 544 WW +V LA+ APS P + L SR C P ++S + H D+ R Sbjct: 465 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC-PSPLSQSSKQHHIRLDNHFDTSTPRS 523 Query: 545 S 547 S Sbjct: 524 S 524 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 Query: 365 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCCYRRPSARSG*RTHY*KDSRASLGCSRQ 544 WW +V LA+ APS P + L SR C P ++S + H D+ R Sbjct: 464 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC-PSPLSQSSKQHHIRLDNHFDTSTPRS 522 Query: 545 S 547 S Sbjct: 523 S 523 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 90 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 381 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 262 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 381 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 262 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 141 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 141 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 236 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 571 CLVLLISWTLSATTKGSSGIFS 506 CLVLL+S +A TK SGIF+ Sbjct: 9 CLVLLVSILRAAVTKPDSGIFT 30 >At1g18670.1 68414.m02330 protein kinase family protein contains Protein kinases ATP-binding region signature, PROSITE:PS00107 and Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 662 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +2 Query: 482 RSG*RTHY*KDSRASLGCSRQSPRDQQDQTGCHLPEAPQGMV*YP*GVQVSASS 643 R+G H DS ++L Q P + + H+ A QG V + +QVS SS Sbjct: 491 RNGHSVHNSIDSDSTLFEKMQKPSNHEKDEASHVKNASQGDVPFSGPLQVSVSS 544 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEF 298 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 266 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 135 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 144 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 31 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +3 Query: 234 VSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAPTKPW 398 + + G + +AE + + + ++P G G G+ G FGN GG F W Sbjct: 81 IRRRMGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGDISKW 138 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 369 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 286 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,336,770 Number of Sequences: 28952 Number of extensions: 300323 Number of successful extensions: 1081 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -