BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0128 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 288 3e-78 SB_54594| Best HMM Match : Ank (HMM E-Value=4.4e-11) 32 0.33 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.57 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.3 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 3.0 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 3.0 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 3.0 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 3.0 SB_41690| Best HMM Match : DSL (HMM E-Value=0) 29 4.0 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 29 4.0 SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) 28 5.3 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 5.3 SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 5.3 SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) 28 7.0 SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) 27 9.3 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 27 9.3 SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) 27 9.3 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 288 bits (706), Expect = 3e-78 Identities = 136/150 (90%), Positives = 142/150 (94%) Frame = +2 Query: 173 WVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAG 352 WVPVTKLGRLV++ KI LE IYLFSLPIKEFEIIDFFLG +L DEVLKIMPVQKQTRAG Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAG 67 Query: 353 QRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGKPHT 532 QRTRFKAFVAIGD+NGH+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIGKPHT Sbjct: 68 QRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Query: 533 VPCKVTGKCGSVTVRLIPAPRGTGIVSAPV 622 VPCKVTGKCGS VRLIPAPRGTGIVSAPV Sbjct: 128 VPCKVTGKCGSTRVRLIPAPRGTGIVSAPV 157 >SB_54594| Best HMM Match : Ank (HMM E-Value=4.4e-11) Length = 733 Score = 32.3 bits (70), Expect = 0.33 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +2 Query: 383 IGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLP-VRRGYWGNKIGKPHTVPCKVTGKC 559 IGD+ G + V+ +K + G++ L+ P +RRG G++ KPH+ P ++ + Sbjct: 137 IGDSGGIDTMDVR-NKATGSVAWGSVTKRPLTSTPDIRRGQTGSEFRKPHSEPRFMSARF 195 Query: 560 GS 565 GS Sbjct: 196 GS 197 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 31.5 bits (68), Expect = 0.57 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 475 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 296 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 295 RAEEEI 278 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.5 bits (68), Expect = 0.57 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 475 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 296 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 295 RAEEEI 278 R ++E+ Sbjct: 577 RNQDEL 582 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 448 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 317 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 302 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 415 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_41690| Best HMM Match : DSL (HMM E-Value=0) Length = 2798 Score = 28.7 bits (61), Expect = 4.0 Identities = 24/83 (28%), Positives = 30/83 (36%), Gaps = 7/83 (8%) Frame = +1 Query: 379 CHWRQQRSYWFGCEVQQGSRHCHSRRYY-PC*VVCFTSSKRLLG*QD------RKATHRP 537 C R + F C GS+ CH Y C + C + G D RK H Sbjct: 1111 CTPRNDSTGHFSCNETTGSKDCHDGWYGGTCSIYCLPHNGSS-GHYDCDASSGRKTCHVD 1169 Query: 538 LQGHRQVWFCNSPADSCPSWYWN 606 G FC+ P DS +Y N Sbjct: 1170 WYGINCTVFCSKPRDSKDHYYCN 1192 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +2 Query: 482 LPVRRGYWGNKIG--KPHTVPCKVTGKCGSVTVRLIPAPRGT 601 LP GYW N G P PC V C + + P P GT Sbjct: 3355 LPCPAGYWCNIKGLADPSISPCPVGHYCLNAIDKPTPCPNGT 3396 >SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2353 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/69 (23%), Positives = 30/69 (43%) Frame = -1 Query: 580 QPDCYRTTLAGDLARDGVWLSDLVTPVTSSNW*NRQLSKDNSASNGSGDFLAALHTQTNM 401 +P C + + D++ + +W + V S +W N +N + D L N+ Sbjct: 626 RPKCKVSCMLNDISTEALWDTGAQISVLSKSWVN-----ENGLNTDLQDIETLLGRDRNL 680 Query: 400 TVVVANGNK 374 V ANG++ Sbjct: 681 NVSAANGSE 689 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 5.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 352 TAHTFQGICCHWRQQRSYW 408 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 476 SVLPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSA 616 +V RG+W + + H + C V +CG + L AP +VS+ Sbjct: 303 TVFTTYRGFWNYALVRKHWLKCVVNLQCG-IAKHLSQAPSNKLLVSS 348 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 350 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 439 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) Length = 174 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 168 KSGFLSPNSAVLFAKEKSTNSRAFTCFLYQSKNSRSL 278 KSG L ++F E +S+AF C LY +KN SL Sbjct: 56 KSGRLGGMPNIVFNSEYQWSSKAFLCTLY-NKNGYSL 91 >SB_36678| Best HMM Match : Aa_trans (HMM E-Value=1.8e-07) Length = 956 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 538 LQGHRQVWFCNS-PADSCPS 594 LQ HR WFC S P +CP+ Sbjct: 87 LQSHRHPWFCVSCPTVTCPT 106 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 329 VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRRGY 502 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 1460 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 1515 Query: 503 W 505 W Sbjct: 1516 W 1516 >SB_17882| Best HMM Match : ShTK (HMM E-Value=1e-05) Length = 387 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 329 VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV--KCSKEVATAIRGAIILAKLSVLPVRRGY 502 +Q+ TR +RT +NN ++ LG+ C + TA+ G +L+ + ++ G Sbjct: 274 IQENTRTSRRTDISYRQLQANNNKNLELGIWRHCGPAILTALSG----RRLACVKIQAGP 329 Query: 503 W 505 W Sbjct: 330 W 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,149,686 Number of Sequences: 59808 Number of extensions: 439067 Number of successful extensions: 1253 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1250 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -