BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0126 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0034 - 12663290-12663355,12663437-12663566,12663903-126639... 32 0.49 09_02_0287 + 6921306-6921493,6922759-6922852,6922912-6922981,692... 30 2.0 03_02_0701 - 10523053-10523220,10523802-10523916,10524102-105241... 29 2.6 07_03_1091 + 23899825-23900649,23900750-23900998,23901104-239011... 29 3.5 04_04_0620 + 26656072-26656417,26656585-26657396 29 3.5 01_05_0542 + 23086931-23087014,23087116-23087206,23087624-230876... 29 3.5 05_03_0393 + 13435581-13435745,13435804-13436418,13437283-134373... 28 6.1 04_04_0785 + 28048368-28048372,28049387-28049447,28050083-280501... 28 6.1 01_05_0451 - 22361617-22361811,22362728-22362842,22363443-223635... 28 6.1 01_05_0412 + 21929446-21929713,21931402-21931501,21931755-21931827 28 6.1 12_02_0093 + 13536684-13536782,13537055-13537057,13537626-135376... 28 8.0 08_01_0643 - 5565687-5566365,5567679-5568040 28 8.0 06_03_0411 - 20520823-20521674 28 8.0 >07_03_0034 - 12663290-12663355,12663437-12663566,12663903-12663990, 12664106-12664178,12666144-12666248,12667610-12667732, 12667821-12667897,12668877-12669006 Length = 263 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 Query: 571 GARAVVSKSHPSWLSLCSPTRPGEAGKASGPPVIFQSSAVLEN 443 G +A +S P W S SP PGEA V+FQ + +N Sbjct: 22 GEQAGISAVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQN 64 >09_02_0287 + 6921306-6921493,6922759-6922852,6922912-6922981, 6923429-6923496,6923575-6923628,6923878-6923895 Length = 163 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 73 LKPEHLYGISSEIVRDRPSFLHFQHLHLRCLSLQTLYHY 189 L P H G+ + DRP LH HL C+ L + HY Sbjct: 67 LVPNHALGLLLDDDHDRP-LLHHDPRHLVCMVLHYVLHY 104 >03_02_0701 - 10523053-10523220,10523802-10523916,10524102-10524172, 10524263-10524420,10524497-10524590,10524678-10524766, 10525322-10525419,10525492-10525625,10525714-10525797, 10525903-10526151 Length = 419 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 138 FPTPAPEVPELTDIVSLPADYVCCIAICGQKCSFYCQ 248 FP+ A +P D V+LP+ C CG+ F Q Sbjct: 75 FPSKAGGIPAWLDPVNLPSGNSRCCGFCGEPLQFVLQ 111 >07_03_1091 + 23899825-23900649,23900750-23900998,23901104-23901195, 23901413-23902193 Length = 648 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 541 GGIC*QLPERLRRRPNNSRAIASRMNLLPDRNRDPLEKIRRETQWA 678 GG+ + P RRR N+ S N +N DP+E +RR+ + A Sbjct: 259 GGVKDRRPVAPRRRGNSVSPSKSGPNSTITQNDDPMESVRRKAEKA 304 >04_04_0620 + 26656072-26656417,26656585-26657396 Length = 385 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +1 Query: 94 GISSEIVRDRPSFLHFQHLH-LRCLS---LQTLYHYPQTMFAVSLFADKNV 234 G E +R +FL +H+H L S L + +PQ +FA +F D+++ Sbjct: 39 GADGETLRQMLAFLGSEHIHQLNATSAGLLAEMQAWPQLVFAAGIFVDRSL 89 >01_05_0542 + 23086931-23087014,23087116-23087206,23087624-23087650, 23087742-23087895,23087958-23088023,23088249-23088292, 23088592-23088683,23088779-23088926,23089356-23089420, 23089495-23089592,23090368-23090392 Length = 297 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +1 Query: 61 VKTFLKPEHLYGISSEIVRDRPSFLHFQ-HLHLRCLSLQTLYHYPQTMFAVSLFADKNVA 237 + T LKPE++ +SSE +R S + Q +H +CL + F + F ++ + Sbjct: 163 IHTDLKPENILLVSSEYIRVPGSKKNSQDEMHFKCLPKSSAIKLID--FGSTAFDNQEHS 220 Query: 238 SIVSDR 255 SIVS R Sbjct: 221 SIVSTR 226 >05_03_0393 + 13435581-13435745,13435804-13436418,13437283-13437349, 13437605-13438239 Length = 493 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 327 DDDVTAYTDGLSNLVHETDLNDDDSI 250 D D DG +L H+TDL+DD I Sbjct: 321 DSDANLDNDGAVDLDHDTDLDDDTGI 346 >04_04_0785 + 28048368-28048372,28049387-28049447,28050083-28050151, 28050249-28050303,28050386-28050433,28050534-28050629, 28050895-28051051,28051250-28051340,28051431-28051559, 28051650-28051803,28052147-28052241,28052316-28052498 Length = 380 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -2 Query: 354 LVEIYENYSDDDVTAYTDGLSNLVHETDLNDDDSITDNRSYI 229 L IY++Y+D T N H LND+ +++ S++ Sbjct: 218 LTSIYDDYADKSTTIVEAEFYNASHLLPLNDEQIVSEASSHL 259 >01_05_0451 - 22361617-22361811,22362728-22362842,22363443-22363513, 22363600-22363754,22363843-22363933,22364049-22364104, 22364910-22365027,22365087-22365200,22365289-22365504 Length = 376 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 138 FPTPAPEVPELTDIVSLPADYVCCIAICGQKCSFYCQ 248 FP A VP D V+LP+ C CG+ F Q Sbjct: 64 FPNKAGGVPAWLDPVNLPSGKSRCCDFCGEPLRFVLQ 100 >01_05_0412 + 21929446-21929713,21931402-21931501,21931755-21931827 Length = 146 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -2 Query: 591 VVRSPAEALGQLLANPTPLG*AFARPPVLVKRERP 487 + R+ + LG+LLA+P+PL A PP L+ R +P Sbjct: 7 LARAGSSLLGRLLASPSPLR-AGLPPPSLLSRIQP 40 >12_02_0093 + 13536684-13536782,13537055-13537057,13537626-13537654, 13539481-13539572,13539979-13540049,13540178-13540266, 13540896-13541019,13541111-13541394,13541831-13541960, 13542482-13543111 Length = 516 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 46 CTVAFVKTFLKPEHLYGISSEIVRDRPSFLHFQHLHLR 159 C V + KP H+ IS+EIV S HF +HLR Sbjct: 218 CRVNYHALRFKP-HIMKISNEIVNKLRSEGHFMSIHLR 254 >08_01_0643 - 5565687-5566365,5567679-5568040 Length = 346 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 381 REVPRGPSGLVEIYENYSDDDVTAYTDGLSNLVHETDLNDDD 256 R +P P G V Y YSD + + Y+D ++ E D +DDD Sbjct: 281 RRLPISP-GFVRYYSVYSDPEYSMYSDEWTS--EEFDDDDDD 319 >06_03_0411 - 20520823-20521674 Length = 283 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 390 ENLREVPRGPSGLVEIYENYSDDDVTAYTDGLSNL 286 E REV R P G + SD+ TA DGL L Sbjct: 63 EEEREVKRSPPGTLRHRRTRSDEAATAALDGLEPL 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,501,669 Number of Sequences: 37544 Number of extensions: 393244 Number of successful extensions: 1129 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1129 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -