BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0125 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 262 1e-70 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 35 0.055 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 32 0.51 SB_31207| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) 30 1.6 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 3.6 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.6 SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) 29 3.6 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 6.3 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 28 6.3 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 6.3 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 28 6.3 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 6.3 SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 8.4 SB_12491| Best HMM Match : rve (HMM E-Value=1.6e-18) 28 8.4 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 8.4 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 8.4 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 262 bits (643), Expect = 1e-70 Identities = 124/212 (58%), Positives = 150/212 (70%) Frame = +1 Query: 64 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQT 243 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGHQT Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQT 59 Query: 244 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXX 423 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 60 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQRRF 119 Query: 424 XXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILK 603 ARGH IEKI E+PLV++D ++ + KT AV L+ + A+ D+ K Sbjct: 120 AVCSALAASALPALIMARGHRIEKIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEK 179 Query: 604 VYKSQRLRAGKGKMRNRRRIQRKVPLIIFNKD 699 S+++RAGKGKMRNRR + RK PLII+N D Sbjct: 180 CIDSKKIRAGKGKMRNRRTVMRKGPLIIYNND 211 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 35.1 bits (77), Expect = 0.055 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVRYPMIRHWF 239 HH CY H Y Y+ H H + R H YP RH++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 337 YRRHPDRTYEYHHHGHAEFGRQHVRYPMIRHWFGDQPP 224 Y +HP T+ YH H R H ++P + H + Q P Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTHRYQYQHP 268 Score = 31.1 bits (67), Expect = 0.90 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 337 YRRHPDRTYEYHHHGHAEFGRQHVRYPMIRHWFGDQ 230 Y +HP T+ YHH H + ++ ++P + H + Q Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRYHQQ 447 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.9 bits (69), Expect = 0.51 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVRY 260 HH RH R + +HHH H E+ R+H RY Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH-RY 353 >SB_31207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -2 Query: 660 TTTVAHFTLTSTKTLRLVHLKDIRPCLEAPQEDDSLFGLVDLLDFVGYNQ 511 +T + HF KT R +H+K P E GL+D+LD G+ Q Sbjct: 18 STVLHHFIDKHAKTPRFLHMKP-----NGPGEGGGSSGLLDMLDAAGFEQ 62 >SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) Length = 532 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 189 VQELEAALLREQGGWSPNQCRIMGYRTCCRPNSACPWWWYS*VR-SGC 329 + E A L+ G P++ I+ +R CCR N C W+W R +GC Sbjct: 221 ITEAAAVLIVVNGTGVPDRL-IVSFRGCCRVN--CNWYWSGWSRCTGC 265 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 361 TYVHHDTCYRRHPDRTYEYHHHGHA 287 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -1 Query: 364 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVRY 260 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 241 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 357 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2325 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 160 DLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARI 285 D+ NDV ++++ + PY + H T E TG+ +A++ Sbjct: 2034 DVTNDVTINVTDVNEAPYDIRLVPSHVTVKEDIRTGQCIAQV 2075 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 259 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 387 G GR + R P GGG R G +G M GG P W R Sbjct: 271 GQGRGMGRGP---GGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 358 YVHHDTCYRR-HPDRTYEYHHHGHAEFGRQHVRYPMIRHWFGDQP 227 Y HH + H + +++HHH H H R+ +I G++P Sbjct: 1032 YHHHRRRHHHYHHQQQHQFHHHHHHTHYNYHYRHFLIIDRPGNKP 1076 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHH 296 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 131 GRGLAAPCTVSLFSEYTDTKGRATDRLI 48 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 154 RPDLVNDVHVSMSKNSRQPYC-VSKEAGHQTSAESWGTGRAV 276 RP +SM K R+PY + +E GH+ S T R V Sbjct: 156 RPGCDTHEKISMEKRKREPYLELIRETGHERQRRSVSTERNV 197 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 358 YVHHDTCYRRHPDRTYEYHHHGH 290 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 364 RTYVH-HDTCYRRHPDRTYEYHHHGHAEFGRQHVRY 260 R Y H CYRR R + YHHH + +RY Sbjct: 216 RCYYHCRRRCYRRR--RRHFYHHHPRRYHNHRRLRY 249 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHH 296 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_12491| Best HMM Match : rve (HMM E-Value=1.6e-18) Length = 1106 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 363 RPHEALAALASSRQPPTAESGLGGSRCCYRRPSTR 467 R H AL A S+ P T SG GG R RR + R Sbjct: 265 RDHTALKAGLSALAPVTDPSGHGGERLAERRHNGR 299 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHHGH 290 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 256 WGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 387 WG G+ + R GGG R G +G M GG P W R Sbjct: 24 WGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,790,627 Number of Sequences: 59808 Number of extensions: 479935 Number of successful extensions: 1545 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1490 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -