BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0125 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 241 4e-64 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 240 7e-64 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.2 At4g38210.1 68417.m05393 expansin, putative (EXP20) similar to a... 29 3.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.2 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.8 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 9.0 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 9.0 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 27 9.0 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 9.0 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 241 bits (589), Expect = 4e-64 Identities = 116/219 (52%), Positives = 144/219 (65%), Gaps = 2/219 (0%) Frame = +1 Query: 49 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 222 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 223 KEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXX 402 K+AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 61 KKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRV 120 Query: 403 XXXXXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLK 582 ARGH IE +PE+PLVV+D + + KT A+ L+++ Sbjct: 121 NVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIG 180 Query: 583 AWSDILKVYKSQRLRAGKGKMRNRRRIQRKVPLIIFNKD 699 A+ D K S +R GKGKMRNRR I RK PL+++ + Sbjct: 181 AYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTE 219 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 240 bits (587), Expect = 7e-64 Identities = 117/216 (54%), Positives = 140/216 (64%), Gaps = 2/216 (0%) Frame = +1 Query: 58 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 231 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 232 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXX 411 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 124 Query: 412 XXXXXXXXXXXXXXXXXXXQARGHIIEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWS 591 ARGH IE +PE+PLVV+D + + KT A+ L+++ A+ Sbjct: 125 MKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYD 184 Query: 592 DILKVYKSQRLRAGKGKMRNRRRIQRKVPLIIFNKD 699 D K S +R GKGKMRNRR I RK PL++F + Sbjct: 185 DAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVFGTE 220 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +1 Query: 73 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 219 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At4g38210.1 68417.m05393 expansin, putative (EXP20) similar to alpha-expansin 3 GI:6942322 from [Triphysaria versicolor]; alpha-expansin gene family, PMID:11641069 Length = 256 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 528 FVGYNQGKFGNLFNNVSSSLNECWDAGSSN---GCRQGRSPLSEVDATMPTPP 379 F GY+ G G LFN SS C + N C QG SP V AT PP Sbjct: 61 FAGYSAGLSGKLFNR-GSSCGACLEVRCVNHIRWCLQG-SPSVVVTATDFCPP 111 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 124 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 219 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 124 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 219 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHHGHAEF 281 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 364 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVRYPMIRH 245 R++ H + +H D + E+HHH H R+H + H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 364 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVRYPMIRH 245 R++ H + +H D + E+HHH H R+H + H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 217 VSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAPTKPW 381 + + G + +AE + + + ++P G G G+ G FGN GG F W Sbjct: 81 IRRRMGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGDISKW 138 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 352 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 269 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,990,089 Number of Sequences: 28952 Number of extensions: 325192 Number of successful extensions: 1134 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -