BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0124 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding pr... 25 1.8 AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-b... 25 1.8 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 3.1 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 7.2 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 23 9.5 >AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding protein AgamOBP26 protein. Length = 131 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 418 GLLKECTSKNNNPCGT 371 GL+K+C K NPC T Sbjct: 100 GLVKKCNHKEANPCET 115 >AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj13 protein. Length = 131 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 418 GLLKECTSKNNNPCGT 371 GL+K+C K NPC T Sbjct: 100 GLVKKCNHKEANPCET 115 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 3.1 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 200 LRTSLGPRGLDKLMVSSDGDVTVTNDGATILKM-MDVEHQIGKLLVQLAQSQDD 358 +R++ G + +L VS VT TI ++ + H +GKLLV+L ++ +D Sbjct: 1063 VRSTNGEEIVSRLFVSKS-KVTPLATKHTIARLELCAAHLLGKLLVKLKRATED 1115 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 398 QQEQQPLWYHHQFRH 354 QQ+QQ L +HH H Sbjct: 153 QQQQQQLHHHHHHHH 167 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -2 Query: 228 RPRGPRDVRRVLAICRAACICDFMASVPVSLFCL 127 + G D+R+V C + I F S + FCL Sbjct: 69 KANGALDMRQVAGQCYSFFIAGFETSASLLSFCL 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,218 Number of Sequences: 2352 Number of extensions: 17241 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -