BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0123 (714 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 456 SSL*TVHSRTGRTFAVFDGHAGARVSAHCAE 548 SS T+H+ G+ F G +S HC E Sbjct: 1230 SSFVTIHNVIGQFLGYFIGLITFVMSQHCVE 1260 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 9.9 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +3 Query: 510 GHAGARVSAHCAENLLECILQTEEFRREDIAEAIRTGFLDLDKKMSELPELSNGKR 677 G A +S + ++ I+ F ED+A+ L LD+K L E+ K+ Sbjct: 295 GTAIVSISTSVSTSVYLAIVFNGLFTEEDVADVPINVTLSLDEKKYILQEVVRVKK 350 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,651 Number of Sequences: 336 Number of extensions: 2850 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -