BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0121 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 1.9 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 5.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.8 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 21 7.8 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 305 PLSNVETRPSPYSQHASHPSDHS 373 P + + RP+P S++A P+D++ Sbjct: 252 PATKSKPRPAPASRNAPEPADNN 274 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 141 PVRTCRQKQHSHS 103 P+ TC +KQH S Sbjct: 240 PITTCNKKQHLES 252 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 433 CESHGTHCNHRTH 395 C+ TH N+RTH Sbjct: 998 CDKTETHTNNRTH 1010 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 452 AARGKPAYLLPFFC 493 A G P LPFFC Sbjct: 115 APTGHPGAALPFFC 128 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 452 AARGKPAYLLPFFC 493 A G P LPFFC Sbjct: 7 APTGHPGAALPFFC 20 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 236 LDRESSPVSSWSNVGRTGDVLPTPLSNVETRPSPYSQHASHP 361 L +ES+ + +V R D+ P P R P + HP Sbjct: 81 LPKESNAIIHIYDVHRNADIYPDPEKLDPDRFLPENVQKRHP 122 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,886 Number of Sequences: 336 Number of extensions: 3750 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -