BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0121 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 25 0.98 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.2 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 6.9 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 22 6.9 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 24.6 bits (51), Expect = 0.98 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 466 FPTSGAVDHNQCESHGTHCNHRTHIRIM 383 +PT + HN ++ CN H+RI+ Sbjct: 203 WPTGRGIYHNDDKTFLVWCNEEDHLRII 230 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/44 (25%), Positives = 17/44 (38%) Frame = -2 Query: 616 PQQLLAEGNATGLRNQGMDLTQVTQIASCRQNGDSKVEDLKTEE 485 P ++A NAT G ++ RQN +D +E Sbjct: 241 PSAVVATSNATAAMTTGTTTIPTRRLRKRRQNDGEGADDRDDDE 284 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.8 bits (44), Expect = 6.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 439 NQCESHGTHCNH 404 NQC++ HC+H Sbjct: 34 NQCQAVNGHCSH 45 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.8 bits (44), Expect = 6.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 439 NQCESHGTHCNH 404 NQC++ HC+H Sbjct: 34 NQCQAVNGHCSH 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,855 Number of Sequences: 438 Number of extensions: 3821 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -