BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0119 (643 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X75498-1|CAA53215.1| 534|Drosophila melanogaster protein A prot... 32 0.57 U62802-1|AAC17459.1| 514|Drosophila melanogaster doom protein. 32 0.57 U30914-1|AAA82990.1| 525|Drosophila melanogaster mod1.8 protein... 32 0.57 U30913-1|AAA82989.1| 520|Drosophila melanogaster mod1.9 protein... 32 0.57 U30905-1|AAA82988.1| 610|Drosophila melanogaster mod2.2 protein. 32 0.57 BT029698-1|ABL75755.1| 488|Drosophila melanogaster IP17441p pro... 32 0.57 BT003579-1|AAO39583.1| 539|Drosophila melanogaster LD27582p pro... 32 0.57 BT003484-1|AAO39487.1| 505|Drosophila melanogaster SD07645p pro... 32 0.57 AJ320163-1|CAC51488.1| 485|Drosophila melanogaster mod(mdg4)53.... 32 0.57 AJ320161-1|CAC51387.1| 476|Drosophila melanogaster mod(mdg4)52.... 32 0.57 AJ277194-1|CAB85489.1| 534|Drosophila melanogaster mod(mdg4)58.... 32 0.57 AJ277193-1|CAB85488.1| 338|Drosophila melanogaster mod(mdg4)46.... 32 0.57 AJ277192-1|CAB85487.1| 610|Drosophila melanogaster mod(mdg4)67.... 32 0.57 AJ277191-1|CAB85486.1| 601|Drosophila melanogaster mod(mdg4)65.... 32 0.57 AJ277190-1|CAB85485.1| 580|Drosophila melanogaster mod(mdg4)64.... 32 0.57 AJ277189-1|CAB85484.1| 567|Drosophila melanogaster mod(mdg4)62.... 32 0.57 AJ277188-1|CAB85483.1| 545|Drosophila melanogaster mod(mdg4)60.... 32 0.57 AJ277187-1|CAB85482.1| 541|Drosophila melanogaster mod(mdg4)59.... 32 0.57 AJ277186-1|CAB85481.1| 541|Drosophila melanogaster mod(mdg4)59.... 32 0.57 AJ277185-1|CAB85480.1| 536|Drosophila melanogaster mod(mdg4)58.... 32 0.57 AJ277183-1|CAB85478.1| 514|Drosophila melanogaster mod(mdg4)56.... 32 0.57 AJ277182-1|CAB85477.1| 510|Drosophila melanogaster mod(mdg4)55.... 32 0.57 AJ277181-1|CAB85476.1| 505|Drosophila melanogaster mod(mdg4)55.... 32 0.57 AJ277180-1|CAB85475.1| 503|Drosophila melanogaster mod(mdg4)55.... 32 0.57 AJ277179-1|CAB85474.1| 506|Drosophila melanogaster mod(mdg4)55.... 32 0.57 AJ277177-1|CAB85472.1| 497|Drosophila melanogaster mod(mdg4)54.... 32 0.57 AJ277176-1|CAB85471.1| 486|Drosophila melanogaster mod(mdg4)53.... 32 0.57 AJ277175-1|CAB85470.1| 387|Drosophila melanogaster mod(mdg4)52.... 32 0.57 AJ277174-1|CAB85469.1| 473|Drosophila melanogaster mod(mdg4)51.... 32 0.57 AE014297-3002|AAN13875.1| 580|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-3001|AAN13874.1| 545|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-3000|AAN13873.1| 506|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2999|AAO41586.1| 486|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2998|AAO41585.1| 567|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2997|AAO41584.1| 505|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2996|AAO41583.1| 490|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2995|AAO41582.1| 500|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2994|AAF55888.1| 534|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2993|AAN13872.1| 603|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2992|AAN13871.1| 503|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2991|AAO41581.1| 526|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2990|AAO41580.1| 610|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2989|AAN13870.1| 510|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2988|AAN13869.1| 476|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2987|AAN13868.1| 539|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2986|AAN13867.1| 473|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2985|AAN13866.1| 541|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2984|AAF55885.2| 498|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2983|AAN13865.1| 514|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2982|AAN13864.1| 430|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2981|AAN13863.1| 497|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2980|AAF55884.1| 520|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2979|AAF55883.2| 536|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2978|AAN13862.1| 485|Drosophila melanogaster CG32491-P... 32 0.57 AE014297-2977|AAF55882.2| 475|Drosophila melanogaster CG32491-P... 32 0.57 U72492-1|AAB92662.1| 675|Drosophila melanogaster fruitless clas... 30 2.3 D84437-1|BAA12663.1| 855|Drosophila melanogaster fruitless prot... 30 2.3 BT024450-1|ABC86512.1| 960|Drosophila melanogaster GH19932p pro... 30 2.3 AF220177-1|AAG28588.1| 956|Drosophila melanogaster fruitless ty... 30 2.3 AF220176-1|AAG28587.1| 855|Drosophila melanogaster fruitless ty... 30 2.3 AF039231-1|AAB96677.1| 776|Drosophila melanogaster fruitless cl... 30 2.3 AE014297-2540|AAN13777.1| 665|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2539|AAF55564.2| 516|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2538|AAS65176.1| 854|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2537|AAS65175.1| 854|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2536|AAF55565.2| 854|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2535|AAS65174.1| 906|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2534|AAS65173.1| 870|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2533|AAN13776.1| 955|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2532|AAN13775.1| 695|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2531|AAS65172.1| 705|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2530|AAF55563.2| 796|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2529|AAN13774.1| 688|Drosophila melanogaster CG14307-P... 30 2.3 AE014297-2528|AAF55562.2| 789|Drosophila melanogaster CG14307-P... 30 2.3 BT025210-1|ABF17901.1| 553|Drosophila melanogaster FI01104p pro... 29 5.4 AY069561-1|AAL39706.1| 764|Drosophila melanogaster LD29352p pro... 29 5.4 AY060324-1|AAL25363.1| 309|Drosophila melanogaster GH20830p pro... 29 5.4 AE014298-2955|AAZ52487.1| 572|Drosophila melanogaster CG33517-P... 29 5.4 AE014298-2121|AAN09659.2| 731|Drosophila melanogaster CG5877-PB... 29 5.4 AE014298-2120|AAF48437.1| 984|Drosophila melanogaster CG5877-PA... 29 5.4 AE014298-818|AAN09155.2| 510|Drosophila melanogaster CG12236-PB... 29 5.4 AE014298-817|AAF46100.1| 553|Drosophila melanogaster CG12236-PA... 29 5.4 X54666-1|CAA38477.1| 728|Drosophila melanogaster BRcore-TNT1-Q1... 28 9.4 X54665-1|CAA38476.1| 514|Drosophila melanogaster BRcore-Z2 prot... 28 9.4 X54664-1|CAA38475.1| 704|Drosophila melanogaster BRcore-NS-Z3 p... 28 9.4 X54663-1|CAA38474.1| 663|Drosophila melanogaster BRcore-Q1-Z1 p... 28 9.4 U51585-1|AAB09760.1| 877|Drosophila melanogaster Broad-Complex ... 28 9.4 AY069756-1|AAL39901.1| 880|Drosophila melanogaster LP12157p pro... 28 9.4 AL009146-4|CAA15629.1| 710|Drosophila melanogaster EG:17A9.1,FB... 28 9.4 AL009146-3|CAA15628.1| 702|Drosophila melanogaster EG:17A9.1,FB... 28 9.4 AL009146-2|CAA15627.1| 880|Drosophila melanogaster EG:17A9.1,FB... 28 9.4 AL009146-1|CAA15626.1| 514|Drosophila melanogaster EG:17A9.1,FB... 28 9.4 AE014298-238|AAN09054.1| 663|Drosophila melanogaster CG11491-PG... 28 9.4 AE014298-237|AAF45648.1| 724|Drosophila melanogaster CG11491-PE... 28 9.4 AE014298-236|AAN09053.1| 880|Drosophila melanogaster CG11491-PC... 28 9.4 AE014298-235|AAF45647.1| 880|Drosophila melanogaster CG11491-PB... 28 9.4 AE014298-234|AAF45650.2| 628|Drosophila melanogaster CG11491-PD... 28 9.4 AE014298-233|AAF45651.2| 702|Drosophila melanogaster CG11491-PA... 28 9.4 AE014298-232|AAN09052.1| 502|Drosophila melanogaster CG11491-PF... 28 9.4 >X75498-1|CAA53215.1| 534|Drosophila melanogaster protein A protein. Length = 534 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >U62802-1|AAC17459.1| 514|Drosophila melanogaster doom protein. Length = 514 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >U30914-1|AAA82990.1| 525|Drosophila melanogaster mod1.8 protein protein. Length = 525 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 11 DALPAFISTAESLQIKGLTDN 31 >U30913-1|AAA82989.1| 520|Drosophila melanogaster mod1.9 protein protein. Length = 520 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >U30905-1|AAA82988.1| 610|Drosophila melanogaster mod2.2 protein. Length = 610 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >BT029698-1|ABL75755.1| 488|Drosophila melanogaster IP17441p protein. Length = 488 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >BT003579-1|AAO39583.1| 539|Drosophila melanogaster LD27582p protein. Length = 539 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >BT003484-1|AAO39487.1| 505|Drosophila melanogaster SD07645p protein. Length = 505 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ320163-1|CAC51488.1| 485|Drosophila melanogaster mod(mdg4)53.4 protein protein. Length = 485 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ320161-1|CAC51387.1| 476|Drosophila melanogaster mod(mdg4)52.2 protein protein. Length = 476 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277194-1|CAB85489.1| 534|Drosophila melanogaster mod(mdg4)58.0 protein. Length = 534 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277193-1|CAB85488.1| 338|Drosophila melanogaster mod(mdg4)46.3 protein. Length = 338 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 7 DALPAFISTAESLQIKGLTDN 27 >AJ277192-1|CAB85487.1| 610|Drosophila melanogaster mod(mdg4)67.2 protein. Length = 610 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277191-1|CAB85486.1| 601|Drosophila melanogaster mod(mdg4)65.0 protein. Length = 601 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 97 DALPAFISTAESLQIKGLTDN 117 >AJ277190-1|CAB85485.1| 580|Drosophila melanogaster mod(mdg4)64.2 protein. Length = 580 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277189-1|CAB85484.1| 567|Drosophila melanogaster mod(mdg4)62.3 protein. Length = 567 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277188-1|CAB85483.1| 545|Drosophila melanogaster mod(mdg4)60.1 protein. Length = 545 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277187-1|CAB85482.1| 541|Drosophila melanogaster mod(mdg4)59.1 protein. Length = 541 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277186-1|CAB85481.1| 541|Drosophila melanogaster mod(mdg4)59.0 protein. Length = 541 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277185-1|CAB85480.1| 536|Drosophila melanogaster mod(mdg4)58.6 protein. Length = 536 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277183-1|CAB85478.1| 514|Drosophila melanogaster mod(mdg4)56.3 protein. Length = 514 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277182-1|CAB85477.1| 510|Drosophila melanogaster mod(mdg4)55.7 protein. Length = 510 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277181-1|CAB85476.1| 505|Drosophila melanogaster mod(mdg4)55.6 protein. Length = 505 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277180-1|CAB85475.1| 503|Drosophila melanogaster mod(mdg4)55.3 protein. Length = 503 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277179-1|CAB85474.1| 506|Drosophila melanogaster mod(mdg4)55.1 protein. Length = 506 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277177-1|CAB85472.1| 497|Drosophila melanogaster mod(mdg4)54.2 protein. Length = 497 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277176-1|CAB85471.1| 486|Drosophila melanogaster mod(mdg4)53.1 protein. Length = 486 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AJ277175-1|CAB85470.1| 387|Drosophila melanogaster mod(mdg4)52.0 protein. Length = 387 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 11 DALPAFISTAESLQIKGLTDN 31 >AJ277174-1|CAB85469.1| 473|Drosophila melanogaster mod(mdg4)51.4 protein. Length = 473 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-3002|AAN13875.1| 580|Drosophila melanogaster CG32491-PN, isoform N protein. Length = 580 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-3001|AAN13874.1| 545|Drosophila melanogaster CG32491-PO, isoform O protein. Length = 545 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-3000|AAN13873.1| 506|Drosophila melanogaster CG32491-PS, isoform S protein. Length = 506 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2999|AAO41586.1| 486|Drosophila melanogaster CG32491-PU, isoform U protein. Length = 486 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2998|AAO41585.1| 567|Drosophila melanogaster CG32491-PV, isoform V protein. Length = 567 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2997|AAO41584.1| 505|Drosophila melanogaster CG32491-PW, isoform W protein. Length = 505 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2996|AAO41583.1| 490|Drosophila melanogaster CG32491-PX, isoform X protein. Length = 490 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2995|AAO41582.1| 500|Drosophila melanogaster CG32491-PY, isoform Y protein. Length = 500 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2994|AAF55888.1| 534|Drosophila melanogaster CG32491-PC, isoform C protein. Length = 534 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2993|AAN13872.1| 603|Drosophila melanogaster CG32491-PE, isoform E protein. Length = 603 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2992|AAN13871.1| 503|Drosophila melanogaster CG32491-PM, isoform M protein. Length = 503 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2991|AAO41581.1| 526|Drosophila melanogaster CG32491-PZ, isoform Z protein. Length = 526 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2990|AAO41580.1| 610|Drosophila melanogaster CG32491-PT, isoform T protein. Length = 610 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2989|AAN13870.1| 510|Drosophila melanogaster CG32491-PK, isoform K protein. Length = 510 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2988|AAN13869.1| 476|Drosophila melanogaster CG32491-PL, isoform L protein. Length = 476 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2987|AAN13868.1| 539|Drosophila melanogaster CG32491-PP, isoform P protein. Length = 539 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2986|AAN13867.1| 473|Drosophila melanogaster CG32491-PJ, isoform J protein. Length = 473 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2985|AAN13866.1| 541|Drosophila melanogaster CG32491-PI, isoform I protein. Length = 541 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2984|AAF55885.2| 498|Drosophila melanogaster CG32491-PB, isoform B protein. Length = 498 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2983|AAN13865.1| 514|Drosophila melanogaster CG32491-PH, isoform H protein. Length = 514 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2982|AAN13864.1| 430|Drosophila melanogaster CG32491-PQ, isoform Q protein. Length = 430 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2981|AAN13863.1| 497|Drosophila melanogaster CG32491-PG, isoform G protein. Length = 497 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2980|AAF55884.1| 520|Drosophila melanogaster CG32491-PD, isoform D protein. Length = 520 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2979|AAF55883.2| 536|Drosophila melanogaster CG32491-PF, isoform F protein. Length = 536 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2978|AAN13862.1| 485|Drosophila melanogaster CG32491-PA, isoform A protein. Length = 485 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >AE014297-2977|AAF55882.2| 475|Drosophila melanogaster CG32491-PR, isoform R protein. Length = 475 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGN 63 + L +FISTAE LQ+KGLT N Sbjct: 99 DALPAFISTAESLQIKGLTDN 119 >U72492-1|AAB92662.1| 675|Drosophila melanogaster fruitless class I female isoform protein. Length = 675 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >D84437-1|BAA12663.1| 855|Drosophila melanogaster fruitless protein protein. Length = 855 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >BT024450-1|ABC86512.1| 960|Drosophila melanogaster GH19932p protein. Length = 960 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 204 LPMFLKTAESLQVRGLTDNNN 224 >AF220177-1|AAG28588.1| 956|Drosophila melanogaster fruitless type-A protein. Length = 956 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 199 LPMFLKTAESLQVRGLTDNNN 219 >AF220176-1|AAG28587.1| 855|Drosophila melanogaster fruitless type-A protein. Length = 855 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AF039231-1|AAB96677.1| 776|Drosophila melanogaster fruitless class I male isoform protein. Length = 776 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 199 LPMFLKTAESLQVRGLTDNNN 219 >AE014297-2540|AAN13777.1| 665|Drosophila melanogaster CG14307-PD, isoform D protein. Length = 665 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2539|AAF55564.2| 516|Drosophila melanogaster CG14307-PA, isoform A protein. Length = 516 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2538|AAS65176.1| 854|Drosophila melanogaster CG14307-PM, isoform M protein. Length = 854 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2537|AAS65175.1| 854|Drosophila melanogaster CG14307-PL, isoform L protein. Length = 854 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2536|AAF55565.2| 854|Drosophila melanogaster CG14307-PC, isoform C protein. Length = 854 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2535|AAS65174.1| 906|Drosophila melanogaster CG14307-PJ, isoform J protein. Length = 906 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 150 LPMFLKTAESLQVRGLTDNNN 170 >AE014297-2534|AAS65173.1| 870|Drosophila melanogaster CG14307-PI, isoform I protein. Length = 870 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 114 LPMFLKTAESLQVRGLTDNNN 134 >AE014297-2533|AAN13776.1| 955|Drosophila melanogaster CG14307-PE, isoform E protein. Length = 955 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 199 LPMFLKTAESLQVRGLTDNNN 219 >AE014297-2532|AAN13775.1| 695|Drosophila melanogaster CG14307-PH, isoform H protein. Length = 695 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2531|AAS65172.1| 705|Drosophila melanogaster CG14307-PK, isoform K protein. Length = 705 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 108 LPMFLKTAESLQVRGLTDNNN 128 >AE014297-2530|AAF55563.2| 796|Drosophila melanogaster CG14307-PG, isoform G protein. Length = 796 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 199 LPMFLKTAESLQVRGLTDNNN 219 >AE014297-2529|AAN13774.1| 688|Drosophila melanogaster CG14307-PF, isoform F protein. Length = 688 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 98 LPMFLKTAESLQVRGLTDNNN 118 >AE014297-2528|AAF55562.2| 789|Drosophila melanogaster CG14307-PB, isoform B protein. Length = 789 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 7 LASFISTAEQLQVKGLTGNQN 69 L F+ TAE LQV+GLT N N Sbjct: 199 LPMFLKTAESLQVRGLTDNNN 219 >BT025210-1|ABF17901.1| 553|Drosophila melanogaster FI01104p protein. Length = 553 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 E L SF+ TAE L V+GLT + E+ Sbjct: 98 EALQSFLQTAELLAVQGLTAEEKEK 122 >AY069561-1|AAL39706.1| 764|Drosophila melanogaster LD29352p protein. Length = 764 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +2 Query: 284 IHWKQVPLVLQKTNL*RYQTKMRTMLSLPK--WNQSLLMRVCGMTMKMARTMTKLITERT 457 I+W+ + L KTN ++K ++++ + W++SLLM + ++ L+TE+ Sbjct: 689 IYWRLYMIALSKTNASFRRSKEVLIMAMDECPWDKSLLMEGAKVLPVKLASLQDLMTEKE 748 Query: 458 ILIW 469 I I+ Sbjct: 749 IRIF 752 >AY060324-1|AAL25363.1| 309|Drosophila melanogaster GH20830p protein. Length = 309 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 E L SF+ TAE L V+GLT + E+ Sbjct: 98 EALQSFLQTAELLAVQGLTAEEKEK 122 >AE014298-2955|AAZ52487.1| 572|Drosophila melanogaster CG33517-PE, isoform E protein. Length = 572 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 475 TGFDGSATGDVNISGGEGGAVG 540 T +DG +GDV ++GG G G Sbjct: 31 TSYDGGGSGDVGVAGGLAGTAG 52 >AE014298-2121|AAN09659.2| 731|Drosophila melanogaster CG5877-PB, isoform B protein. Length = 731 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +2 Query: 284 IHWKQVPLVLQKTNL*RYQTKMRTMLSLPK--WNQSLLMRVCGMTMKMARTMTKLITERT 457 I+W+ + L KTN ++K ++++ + W++SLLM + ++ L+TE+ Sbjct: 656 IYWRLYMIALSKTNASFRRSKEVLIMAMDECPWDKSLLMEGAKVLPVKLASLQDLMTEKE 715 Query: 458 ILIW 469 I I+ Sbjct: 716 IRIF 719 >AE014298-2120|AAF48437.1| 984|Drosophila melanogaster CG5877-PA, isoform A protein. Length = 984 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +2 Query: 284 IHWKQVPLVLQKTNL*RYQTKMRTMLSLPK--WNQSLLMRVCGMTMKMARTMTKLITERT 457 I+W+ + L KTN ++K ++++ + W++SLLM + ++ L+TE+ Sbjct: 909 IYWRLYMIALSKTNASFRRSKEVLIMAMDECPWDKSLLMEGAKVLPVKLASLQDLMTEKE 968 Query: 458 ILIW 469 I I+ Sbjct: 969 IRIF 972 >AE014298-818|AAN09155.2| 510|Drosophila melanogaster CG12236-PB, isoform B protein. Length = 510 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 E L SF+ TAE L V+GLT + E+ Sbjct: 98 EALQSFLQTAELLAVQGLTAEEKEK 122 >AE014298-817|AAF46100.1| 553|Drosophila melanogaster CG12236-PA, isoform A protein. Length = 553 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 E L SF+ TAE L V+GLT + E+ Sbjct: 98 EALQSFLQTAELLAVQGLTAEEKEK 122 >X54666-1|CAA38477.1| 728|Drosophila melanogaster BRcore-TNT1-Q1-Z1 protein. Length = 728 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >X54665-1|CAA38476.1| 514|Drosophila melanogaster BRcore-Z2 protein. Length = 514 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >X54664-1|CAA38475.1| 704|Drosophila melanogaster BRcore-NS-Z3 protein. Length = 704 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >X54663-1|CAA38474.1| 663|Drosophila melanogaster BRcore-Q1-Z1 protein. Length = 663 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >U51585-1|AAB09760.1| 877|Drosophila melanogaster Broad-Complex protein isoform Z4 protein. Length = 877 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AY069756-1|AAL39901.1| 880|Drosophila melanogaster LP12157p protein. Length = 880 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AL009146-4|CAA15629.1| 710|Drosophila melanogaster EG:17A9.1,FBgn0000210;br protein. Length = 710 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AL009146-3|CAA15628.1| 702|Drosophila melanogaster EG:17A9.1,FBgn0000210;br protein. Length = 702 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AL009146-2|CAA15627.1| 880|Drosophila melanogaster EG:17A9.1,FBgn0000210;br protein. Length = 880 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AL009146-1|CAA15626.1| 514|Drosophila melanogaster EG:17A9.1,FBgn0000210;br protein. Length = 514 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-238|AAN09054.1| 663|Drosophila melanogaster CG11491-PG, isoform G protein. Length = 663 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-237|AAF45648.1| 724|Drosophila melanogaster CG11491-PE, isoform E protein. Length = 724 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-236|AAN09053.1| 880|Drosophila melanogaster CG11491-PC, isoform C protein. Length = 880 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-235|AAF45647.1| 880|Drosophila melanogaster CG11491-PB, isoform B protein. Length = 880 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-234|AAF45650.2| 628|Drosophila melanogaster CG11491-PD, isoform D protein. Length = 628 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-233|AAF45651.2| 702|Drosophila melanogaster CG11491-PA, isoform A protein. Length = 702 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 >AE014298-232|AAN09052.1| 502|Drosophila melanogaster CG11491-PF, isoform F protein. Length = 502 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 1 EELASFISTAEQLQVKGLTGNQNEE 75 + L SF+ TAE L+V GLT Q E+ Sbjct: 98 KSLQSFLKTAEVLRVSGLTQQQAED 122 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.309 0.128 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,298,580 Number of Sequences: 53049 Number of extensions: 456405 Number of successful extensions: 1698 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 1633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1698 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -