BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0119 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 25 0.47 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 0.82 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.8 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.7 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 25.4 bits (53), Expect = 0.47 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 7 LASFISTAEQLQVKGLT 57 L+SF+ TAE L+V GLT Sbjct: 100 LSSFLKTAEVLRVSGLT 116 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.6 bits (51), Expect = 0.82 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 513 NINISSCRAIKTSHFHIRIVLSVISFVIVRAIFIVIPHTLI 391 N +S R +++ H ++ +SF IV +I+I TL+ Sbjct: 388 NSEVSKSRTKESAWRHFAAIIEWLSFFIVIFTYIIILITLV 428 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/11 (72%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = -3 Query: 140 CLCCDDL-GPG 111 C CCD+L GPG Sbjct: 13 CWCCDNLGGPG 23 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -3 Query: 350 SSSSGIVTNSSFAEPEGPASSGSTHFRFAGPLCEEEELFDAIDGL 216 SSS + SSF P S GS ++ L ++L D I+ L Sbjct: 88 SSSPSPSSPSSFFSSVSPTSLGSENYTGISDLFVFDDLNDYINRL 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.309 0.128 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,760 Number of Sequences: 438 Number of extensions: 2610 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -