BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0118 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_36080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_49906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 28 7.7 SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) 28 7.7 >SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 712 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/75 (30%), Positives = 37/75 (49%) Frame = +1 Query: 322 LNEELSYCRGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIWACVPMLCSRTYREC 501 L +E++Y LG+P++M+ + NLA + SH L W VPM CS + Sbjct: 118 LMQEVNYAIHLGLPSVMLELGNYNIINLAHYVNDILINSHVQQL-WIKVPMRCSEDMCDK 176 Query: 502 TEDDEEEKAWNEPWY 546 + DEE+ + +Y Sbjct: 177 SLFDEEDSMGVQFYY 191 >SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1564 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 464 VYLCYVVEHIENALKMMKKRKLGMSPGTGGP-NSMSALIGINVLVLFWELSADL 622 V LCY++ ++ N + ++KK K GTG P S ++ LV F +++++ Sbjct: 414 VSLCYILSNLGNVVSLIKKGKTNCRAGTGIPLQRKSQTSSVSPLVQFEGVTSEM 467 >SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/85 (27%), Positives = 37/85 (43%) Frame = +1 Query: 319 YLNEELSYCRGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIWACVPMLCSRTYRE 498 +LN +C G PA+++S + + + A+ L Y+ P + RTY Sbjct: 826 FLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI----------RTY-- 870 Query: 499 CTEDDEEEKAWNEPWYWWSKFHERL 573 C E+ + K E WW F ER+ Sbjct: 871 CEENRIQWKFNRERAPWWGGFFERI 895 >SB_36080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 28.7 bits (61), Expect = 4.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 113 LQCSYSFIVRPLFTHVFVG 169 ++C ++RP FTH+F+G Sbjct: 32 IECESPMVIRPFFTHLFLG 50 >SB_49906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 44 QQEISCGYEYIITADLQTCLTEALQCSYSFIVRP 145 QQ+I+ GYE + A L +C T+ +Q + ++ P Sbjct: 8 QQQITTGYESVAFAILSSCRTQFMQITDRILLYP 41 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 529 WNEPWYWWSKFHERLDWDKRV 591 WN+PWY W K + D DK V Sbjct: 26 WNKPWYQWDK--KENDADKTV 44 >SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1238 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +1 Query: 544 YWWSKFHERLDWDK-RVGVVLGVVC 615 YWW R+ D+ R GV LGV C Sbjct: 701 YWWLSMMSRMTRDQQRSGVTLGVYC 725 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,854,309 Number of Sequences: 59808 Number of extensions: 478439 Number of successful extensions: 1137 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -