BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0117 (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 118 3e-29 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 23 1.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 2.9 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 118 bits (284), Expect = 3e-29 Identities = 56/92 (60%), Positives = 73/92 (79%), Gaps = 1/92 (1%) Frame = +1 Query: 40 MIGQFGVGFYSAFLVADSVTVASKHNDDRQHVWQSDA-NSFSVAEDPRGDTLKRGTHLTL 216 MIGQFGVGFYSA+LVAD VTV SK+NDD Q+VW+S A SF+V +D RG+ L RGT + L Sbjct: 123 MIGQFGVGFYSAYLVADKVTVVSKNNDDEQYVWESSAGGSFTVTQD-RGEPLGRGTKIVL 181 Query: 217 HMKEEASDYLQADTIRALVKKYSQFINFPIYL 312 HMKE+ +++L+ I+ +VKK+SQFI +PI L Sbjct: 182 HMKEDQTEFLEEHKIKEIVKKHSQFIGYPIKL 213 Score = 29.9 bits (64), Expect = 0.014 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 448 ELMNDNKPIWTRKPSEVQDDEY 513 E +N KPIWTR ++ +EY Sbjct: 277 EELNKTKPIWTRNADDISQEEY 298 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 91 SVTVASKHNDDRQ-HVWQSDANSFSV 165 SV SK+ DD + H WQ+D + +V Sbjct: 104 SVNENSKNGDDDEGHEWQADVSEEAV 129 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 49 QFGVGFYSAFLVADSVTVASKH-NDDRQHVWQSDANSFSVAED 174 QFG+ + + T+ S DD W D SFS+ D Sbjct: 11 QFGLQLECNWSSGPNATLQSSACTDDLSSCWSEDMGSFSLPLD 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.315 0.130 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,922 Number of Sequences: 336 Number of extensions: 885 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -