BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0117 (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) 130 7e-31 SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) 108 2e-24 SB_87| Best HMM Match : HSP90 (HMM E-Value=9.4e-10) 79 2e-15 SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_53327| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 >SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) Length = 855 Score = 130 bits (314), Expect = 7e-31 Identities = 55/80 (68%), Positives = 71/80 (88%) Frame = +1 Query: 82 VADSVTVASKHNDDRQHVWQSDANSFSVAEDPRGDTLKRGTHLTLHMKEEASDYLQADTI 261 +AD V V SK+NDD+Q++W+SDA+SFS++EDPRG TLKRGT ++LH+KEEA DYL+ +TI Sbjct: 175 IADRVIVTSKNNDDKQYIWESDASSFSISEDPRGPTLKRGTTISLHLKEEARDYLEPETI 234 Query: 262 RALVKKYSQFINFPIYLWAS 321 + LVKKYSQFINFPI+LW S Sbjct: 235 KDLVKKYSQFINFPIFLWTS 254 Score = 57.2 bits (132), Expect = 8e-09 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +1 Query: 436 VWDWELMNDNKPIWTRKPSEVQDDEYTQ 519 VWDWE +N NKPIWTRKP E++DDEY + Sbjct: 315 VWDWEQLNTNKPIWTRKPKEIKDDEYNE 342 >SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) Length = 581 Score = 108 bits (260), Expect = 2e-24 Identities = 50/92 (54%), Positives = 70/92 (76%), Gaps = 1/92 (1%) Frame = +1 Query: 40 MIGQFGVGFYSAFLVADSVTVASKHNDDRQHVWQSDA-NSFSVAEDPRGDTLKRGTHLTL 216 MIGQFGVGFYSA+LVA+ V V +KHNDD Q++W+S A SF+V D G+ L RGT + L Sbjct: 66 MIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYIWESAAGGSFTVKRD-SGEPLGRGTKIVL 124 Query: 217 HMKEEASDYLQADTIRALVKKYSQFINFPIYL 312 ++KE+ ++YL+ I+ +VKK+SQFI +P+ L Sbjct: 125 YLKEDQTEYLEEKRIKEIVKKHSQFIGYPLSL 156 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 442 DWELMNDNKPIWTRKPSEVQDDEY 513 + E +N KPIW R E+ +EY Sbjct: 217 EMEELNKTKPIWMRNADEITTEEY 240 >SB_87| Best HMM Match : HSP90 (HMM E-Value=9.4e-10) Length = 739 Score = 79.0 bits (186), Expect = 2e-15 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 3/104 (2%) Frame = +1 Query: 10 EKSAAPEMNDMIGQFGVGFYSAFLVADSVTVASK--HNDDRQHVWQSDAN-SFSVAEDPR 180 + A ++IGQFGVGFYS F+VAD V V +K + + + W SD + S+ AE Sbjct: 165 KNEARSSHENIIGQFGVGFYSTFMVADKVDVYTKSYQPNSQGYFWTSDGSGSYEYAE--- 221 Query: 181 GDTLKRGTHLTLHMKEEASDYLQADTIRALVKKYSQFINFPIYL 312 + + RGT L LH+KE+ + + +V++YS F+ FPIYL Sbjct: 222 ANGVARGTKLVLHLKEDCKRFAMKTAVEDIVQRYSNFVGFPIYL 265 >SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1535 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 10 EKSAAPEMNDMIGQFGVGFYSAFLVADSVTVASKHNDD 123 E+ P +ND++ ++G S + D + + SKH DD Sbjct: 80 EQDHQPVVNDLLSEYGHAAASCDDIDDGIMIISKHCDD 117 >SB_53327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 25 PEMNDMIGQFGVGFYSAFLVADSVTVASKHNDD 123 P +ND++ ++G S + D + + SKH DD Sbjct: 106 PVVNDLLSEYGHAAASCDDIDDGIMIISKHCDD 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.130 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,161,985 Number of Sequences: 59808 Number of extensions: 114519 Number of successful extensions: 508 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -