BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0116 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 27 0.17 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.1 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.8 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 4.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.5 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.6 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 8.6 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 8.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 8.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 8.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 8.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 8.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 8.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 8.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 8.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 8.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.6 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 21 8.6 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 27.1 bits (57), Expect = 0.17 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 2/94 (2%) Frame = +3 Query: 429 SRTEEGRDYKVDNKSGLSRERQC*YNLRGLQEHNECREARKPNLHRRWP-HLYHLSVGQR 605 SR E+G Y+ D + SR+R Y + + +++ + +L R Y S + Sbjct: 237 SRHEDGNSYRNDGERSCSRDRSREYKKKD-RRYDQLHNVEEKHLRERTSRRRYSRSRERE 295 Query: 606 *HSYVYH*K-RRYARIPERRQPARHTRGPTRSLR 704 SY + R Y R R RG +R R Sbjct: 296 QKSYKNEREYREYRETSRERSRDRRERGRSREHR 329 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 209 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 102 +++ A IV I PER D E CWS EP+ Sbjct: 809 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 844 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 209 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 102 +++ A IV I PER D E CWS EP+ Sbjct: 847 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 882 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRER 491 R+R S SR E + YK + K RER Sbjct: 36 RKRYSRSREREQKSYKNERKYRKYRER 62 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRER 491 R+R S SR E + YK + K RER Sbjct: 36 RKRYSRSREREQKSYKNERKYRKYRER 62 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E R YK +N RE Sbjct: 269 RKRYSRSREREQRSYKNENSYRKYRE 294 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 623 PLKTEVCS-DPGKASTCPAYPWTY 691 PL +E G AS C A+PW + Sbjct: 276 PLSSEATDLRMGVASFCKAFPWHF 299 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.5 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRERQC*YNLRGLQEHNECREAR 548 R+R S SR E + YK +N RE R +E RE R Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRETSK-ERSRDRRERGRSREHR 313 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREKKSYKNENSYRKYRE 61 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 36 RKRYSRSREREQKSYKNENSYRKYRE 61 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 258 RKRYSRSREREQKSYKNENSYRKYRE 283 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 258 RKRYSRSREREQKSYKNENSYRKYRE 283 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSRSREREQKSYKNENSYRKYRE 294 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 274 RKRYSRSREREQKSYKNENSYRKYRE 299 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSCSREREQKSYKNENSYRKYRE 294 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 411 RRRLS*SRTEEGRDYKVDNKSGLSRE 488 R+R S SR E + YK +N RE Sbjct: 269 RKRYSRSREREKKSYKNENSYRKYRE 294 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 588 DDRDEAIVDEDSVSWLHDIRYVLVVHVNCI 499 DD +AI+D D S +I L V CI Sbjct: 71 DDLIKAIIDSDRHSTTREIAEKLHVSHTCI 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,205 Number of Sequences: 438 Number of extensions: 4311 Number of successful extensions: 39 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -