BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0112 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 192 6e-51 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.8 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 4.9 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.5 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 192 bits (469), Expect = 6e-51 Identities = 95/136 (69%), Positives = 111/136 (81%) Frame = +1 Query: 7 RSFQKQPTVFLNRKKGIGVKRSRKPLRYHKDVGLGFKTPREAIEGTYIDKKCPFTGNVSI 186 R+FQKQ + LNRK V R +K LR H +GLGFKTP+EAI GTYIDKKCPFTG++SI Sbjct: 8 RAFQKQLGINLNRKN---VSR-KKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGHISI 63 Query: 187 RGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTI 366 RGRILTGVV+K + + IRRDYL ++ KY+ FEKR+RNM +HLSPCFRDVE GDIVT+ Sbjct: 64 RGRILTGVVRKCIV--LLYIRRDYLQFIRKYDTFEKRNRNMRLHLSPCFRDVEAGDIVTL 121 Query: 367 GECRPLSKTVRFNVLK 414 GECRPLSKTVRFNVLK Sbjct: 122 GECRPLSKTVRFNVLK 137 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.8 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -1 Query: 204 GEDAAADRNVTSEGTLLVNVGT-LNRLTGSLETEAHILVVSQRFSAPLHTNTFLAVQKDC 28 GED D+ S+GTLL +GT N + + T+ + +R ++ + +FL DC Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGTWSNEMAVGVGTDNDMGEEGRRGAS---SPSFLRYDSDC 1323 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 171 SEGTLL-VNVGTLNRLTGSLETEAHILVVSQRFSAPLHTNTFLAV 40 ++G +L +++GTL++L GSL E + +P H L++ Sbjct: 303 AQGDVLELDIGTLDQLAGSLADELTLQQNDYFKGSPAHRKPLLSM 347 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 126 TGSLETEAHILVVSQRFS 73 TGS+E+ AH+L RF+ Sbjct: 951 TGSVESVAHVLFYCPRFA 968 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,130 Number of Sequences: 2352 Number of extensions: 13070 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -