BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0112 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73426-1|CAA97792.1| 155|Caenorhabditis elegans Hypothetical pr... 208 2e-54 Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical pr... 29 2.9 U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical pr... 28 5.1 >Z73426-1|CAA97792.1| 155|Caenorhabditis elegans Hypothetical protein F40F11.1 protein. Length = 155 Score = 208 bits (509), Expect = 2e-54 Identities = 98/139 (70%), Positives = 113/139 (81%) Frame = +1 Query: 1 TERSFQKQPTVFLNRKKGIGVKRSRKPLRYHKDVGLGFKTPREAIEGTYIDKKCPFTGNV 180 TER+F KQPTV LN K I + S+K RY ++VGLGFK PR+A+EGTYIDKKCP+ GNV Sbjct: 5 TERAFLKQPTVNLNNKARI-LAGSKKTPRYIREVGLGFKAPRDAVEGTYIDKKCPWAGNV 63 Query: 181 SIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIV 360 IRG ILTGVV K KM RTIV+RRDYLHY+ KY R+EKRH+N+ H SP FRD+ GD+V Sbjct: 64 PIRGMILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHCSPAFRDIHPGDLV 123 Query: 361 TIGECRPLSKTVRFNVLKV 417 TIGECRPLSKTVRFNVLKV Sbjct: 124 TIGECRPLSKTVRFNVLKV 142 >Z69883-3|CAA93741.2| 450|Caenorhabditis elegans Hypothetical protein C27C12.4 protein. Length = 450 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 213 SENEDAENYRDPPRLPSLPTQIQ*VRETAQEYVRAFVALL 332 S+NED E+ DP LP + + E +R+ +ALL Sbjct: 199 SQNEDIESSEDPLILPETENDVTLPASSVSEQLRSTIALL 238 >U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical protein F47D12.5 protein. Length = 633 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 411 QNIESNCFGQRSAFADRYNITNLHVPEARRQMHGH 307 +++E CF Q F D +N+T L + + R M+ H Sbjct: 129 RSVELECFEQ---FVDLFNLTGLRILDVSRSMYKH 160 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,467,917 Number of Sequences: 27780 Number of extensions: 288983 Number of successful extensions: 795 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -