BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0111 (724 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.12c |||20S proteasome component beta 3|Schizosaccharomyce... 27 3.6 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 8.3 >SPCC63.12c |||20S proteasome component beta 3|Schizosaccharomyces pombe|chr 3|||Manual Length = 204 Score = 26.6 bits (56), Expect = 3.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 599 RKKGPYFSFPITLCFNRDNS 658 ++ GPYFSFP+ + DN+ Sbjct: 98 KRFGPYFSFPVVAGVSNDNT 117 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +2 Query: 563 CPIQVSIFKFIVRKKGPYFSFPITLCFNRDNSFPVHTT 676 C F VR+ G Y LCF + +FP+ +T Sbjct: 321 CVFLYKAMDFFVREYGSYPFNSFKLCFVDETNFPIIST 358 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,930,215 Number of Sequences: 5004 Number of extensions: 60257 Number of successful extensions: 140 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -