BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0111 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) 29 3.8 SB_49421| Best HMM Match : 7tm_1 (HMM E-Value=3e-07) 28 6.7 >SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) Length = 784 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 569 IQVSIFKFIVRKKGPYFSFPITLCFNRDNSFPVHTTSV 682 IQ S+ ++ GPY+ + R S PVHTTS+ Sbjct: 168 IQHSVRTTSIKHPGPYYRYTAPRSILRVYSTPVHTTSI 205 >SB_49421| Best HMM Match : 7tm_1 (HMM E-Value=3e-07) Length = 265 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -1 Query: 244 IWALNWVTTNVLVILQTSAMIITVDLLNERMAHQQPQTKTDSE 116 IW+ N + + L ++ S II V++ +R+ P T+ D E Sbjct: 153 IWSRNVLAFSSLAVICCSYFIILVNVRKQRIKLSHPSTRRDRE 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,694,188 Number of Sequences: 59808 Number of extensions: 401089 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -