BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0100 (721 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039050-9|AAC47940.1| 499|Caenorhabditis elegans Cytochrome p4... 31 1.1 U40410-5|AAA81394.3| 1199|Caenorhabditis elegans Hypothetical pr... 29 3.3 >AF039050-9|AAC47940.1| 499|Caenorhabditis elegans Cytochrome p450 family protein34A10 protein. Length = 499 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 4/50 (8%) Frame = -1 Query: 433 IQTIINGNILRA--QD--IDNKSMATGHSIITKLVLIQSDTLIPKNPTEY 296 I +I+N N+ R QD I + +A+G + T++ ++ +D + KNPTE+ Sbjct: 369 IASILNINLFRKIEQDTEIAGQPLASGCVVTTQMSMLHTDVEVYKNPTEF 418 >U40410-5|AAA81394.3| 1199|Caenorhabditis elegans Hypothetical protein C54G7.4 protein. Length = 1199 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 424 IINGNILRAQDIDNKSMATGHSIITKLVLIQSDTLIPKNPTEYCM 290 I +GN + Q N S+ +++ V I+ L P+NPT+ C+ Sbjct: 627 ICDGNSILEQSSVNGSILLFQNLVVTAVNIEKILLTPENPTKTCI 671 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,144,199 Number of Sequences: 27780 Number of extensions: 270078 Number of successful extensions: 471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -