BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0076 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 4.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 6.0 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 456 SCLPPRFVPVPHPSCRFELDE 394 +CL P + HP R EL + Sbjct: 321 ACLDPYVYAISHPKYRLELQK 341 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.5 Identities = 16/68 (23%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +3 Query: 282 ENSNPRMMNRLPMPGMNQDSPMTSPHAFNNKSASAMSPHLTQ----SGMMGAGPGQTAAV 449 + P + + P P SPH P+ +Q G GA P Q + Sbjct: 3 QQKQPIITQQSQQPSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQ 62 Query: 450 DMSKAAQG 473 M A G Sbjct: 63 MMISPASG 70 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 237 SRKNDVSLTAPVAPVEN--SNPRMMNRLPMPGMNQDSPMTS 353 S KN++S PV PV++ +P ++ P ++P+T+ Sbjct: 17 SVKNEISTVEPVDPVKSLVCSPD-LSVFTSPACGSETPLTN 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,653 Number of Sequences: 438 Number of extensions: 3496 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -