BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0070 (513 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 43 2e-06 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 8.5 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 8.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 42.7 bits (96), Expect = 2e-06 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SG++L Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDL 198 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.6 bits (41), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 450 LQRTDAYSSSRLADSYVW 503 L T Y SSR +DS +W Sbjct: 13 LYLTAIYVSSRKSDSGIW 30 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 20.6 bits (41), Expect = 8.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 96 AIIPVTRHD*FSDLVEDVYL 37 A++PV +H LV VYL Sbjct: 18 ALLPVKKHHRLEKLVPCVYL 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,266 Number of Sequences: 336 Number of extensions: 2195 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -