BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0070 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 6e-10 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 56 1e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 50 9e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 3e-06 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 47 8e-06 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 3e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 31 0.42 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 31 0.42 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 30 0.97 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 30 0.97 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 1.3 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 2.2 SB_31039| Best HMM Match : Fibrinogen_C (HMM E-Value=4.2e-39) 29 3.0 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 5.2 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 74.9 bits (176), Expect = 3e-14 Identities = 31/91 (34%), Positives = 51/91 (56%) Frame = +1 Query: 241 PDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 420 P+ + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 + ++ + Y +PT IQ Q PIA+SG+++ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDI 557 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 61.7 bits (143), Expect = 3e-10 Identities = 31/97 (31%), Positives = 54/97 (55%), Gaps = 1/97 (1%) Frame = +1 Query: 226 QNMRRPDWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFE 402 + ++ D +V QPF K+FY P + K +P E +E+R + E + V G P++ + Sbjct: 49 EELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWA 108 Query: 403 EANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 + + +K Y++PTPIQAQ P+ MSG+++ Sbjct: 109 QTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDM 145 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 6e-10 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +1 Query: 313 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 56.4 bits (130), Expect = 1e-08 Identities = 24/76 (31%), Positives = 43/76 (56%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGKNL 513 PIQ Q P+ +SG+++ Sbjct: 221 PIQMQVLPVLLSGRDV 236 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/59 (33%), Positives = 36/59 (61%) Frame = +1 Query: 337 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + +++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDI 141 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.4 bits (110), Expect = 3e-06 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 47.2 bits (107), Expect = 8e-06 Identities = 23/81 (28%), Positives = 41/81 (50%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGKNL 513 ++ PTPIQ Q MSG+++ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDI 112 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+++ Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDV 751 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+++ Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDV 174 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 VSG I F E F + + + GY+ PTP+Q PI M+G++L Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDL 519 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 I FE+ + + + V GYK+PTP+Q PI ++L Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDL 915 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 31.5 bits (68), Expect = 0.42 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 + V +G+ PTPIQA P+A+ GK++ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDV 50 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 ++ F + G+ G+ PT IQ QG P+A+SG+++ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDV 90 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 0.74 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.3 bits (65), Expect = 0.97 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 FE+ + G+ G+ +P+PIQ + P+A++G+++ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDI 87 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 30.3 bits (65), Expect = 0.97 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNL 513 FE+ + G+ G+ +P+PIQ + P+A++G+++ Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDI 87 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 283 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 423 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 349 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_31039| Best HMM Match : Fibrinogen_C (HMM E-Value=4.2e-39) Length = 411 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 268 VGVKQNPNLGDACSDLQRILFSHQ--ILQILQIYCH 167 +GVKQ P L +CS++Q F+H I I CH Sbjct: 269 IGVKQQPPLLPSCSEIQSEHFAHTSGIFPIALTPCH 304 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 232 CSDLQRILFSHQILQILQIYCHRC-QIETN 146 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 163 CQIETNYRRICCLLQIWN-HRFHGYYSS 83 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,465,466 Number of Sequences: 59808 Number of extensions: 240920 Number of successful extensions: 738 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -