BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0060 (395 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 23 0.83 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 23 0.83 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 1.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 5.9 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 23.4 bits (48), Expect = 0.83 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 124 VVICEDD--KKANLLLDQSPRCLRKLITIKEVSPSTFQRAKSRGVEI 258 V C D KK + +PR LR+L T E + T A +EI Sbjct: 66 VEYCTQDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIEI 112 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 23.4 bits (48), Expect = 0.83 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 124 VVICEDD--KKANLLLDQSPRCLRKLITIKEVSPSTFQRAKSRGVEI 258 V C D KK + +PR LR+L T E + T A +EI Sbjct: 66 VEYCTQDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIEI 112 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 301 HPFVPPKPENLCTIC 345 HPF+ P + CT+C Sbjct: 763 HPFLIPTGFDSCTVC 777 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 20.6 bits (41), Expect = 5.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 393 VSQHNAFRHPSRSXRITYCTKV 328 V HN R P+R+ ++Y T + Sbjct: 50 VIYHNNPRDPNRARSVSYSTVI 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,435 Number of Sequences: 336 Number of extensions: 1852 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8435920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -