BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0060 (395 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 2.3 AF203334-1|AAF19829.1| 110|Anopheles gambiae immune-responsive ... 24 2.3 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 5.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 7.1 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 22 7.1 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 2.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 337 YKGFPVSVGQKDGPF 293 YK FPV G D PF Sbjct: 1273 YKKFPVLAGDDDAPF 1287 >AF203334-1|AAF19829.1| 110|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR5 protein. Length = 110 Score = 23.8 bits (49), Expect = 2.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 300 PSFCPTETGKPLYNMLYVRNDW 365 P+ C E+G LY +Y+ +DW Sbjct: 54 PTAC-AESGTGLYGTVYMTSDW 74 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 22.6 bits (46), Expect = 5.4 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = -3 Query: 387 QHNAFRHPSRSXRITYCTKVFRFRWDKRMVLLSSLYFDVRELQNLNTTALGALK 226 +H F+H + S + K + D +++ +L D+ ++NL +T LK Sbjct: 229 EHYIFQHDNDSKHTSRTVKCYLANQDVQVLPWPALSPDLNPIENLWSTLKRQLK 282 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 7.1 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 271 DVEIQGAQKDHPFVPPKPE 327 D+ + +++D P +PP PE Sbjct: 2967 DMSTETSKRDIPNIPPAPE 2985 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 7.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 101 MKAQAFAPSVSYNGTI 54 M + +F P VS NGT+ Sbjct: 1 MASHSFLPGVSVNGTV 16 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,530 Number of Sequences: 2352 Number of extensions: 8739 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -