BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0059 (609 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A3DKM5 Cluster: Binding-protein-dependent transport sys... 37 0.33 UniRef50_A2DTE8 Cluster: Clan CA, family C2, calpain-like cystei... 36 0.57 UniRef50_A1Z398 Cluster: NADH-ubiquinone oxidoreductase chain 5;... 36 0.75 UniRef50_Q04WB4 Cluster: Peptidase, M50 family; n=4; Leptospira|... 35 1.7 UniRef50_Q557G7 Cluster: Putative uncharacterized protein; n=1; ... 34 3.0 UniRef50_Q838Y3 Cluster: Membrane protein, putative; n=1; Entero... 33 5.3 UniRef50_Q9XMT1 Cluster: Orf365; n=5; Tetrahymena|Rep: Orf365 - ... 33 5.3 UniRef50_Q4Y399 Cluster: Putative uncharacterized protein; n=1; ... 33 5.3 UniRef50_UPI0001509C56 Cluster: hypothetical protein TTHERM_0064... 33 7.0 UniRef50_Q6LFI3 Cluster: Putative uncharacterized protein; n=1; ... 33 7.0 UniRef50_A0NDS1 Cluster: ENSANGP00000030277; n=1; Anopheles gamb... 33 7.0 UniRef50_Q5AGI5 Cluster: Putative uncharacterized protein; n=2; ... 33 7.0 UniRef50_Q5A659 Cluster: Putative uncharacterized protein; n=1; ... 32 9.3 >UniRef50_A3DKM5 Cluster: Binding-protein-dependent transport systems inner membrane component; n=1; Staphylothermus marinus F1|Rep: Binding-protein-dependent transport systems inner membrane component - Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) Length = 248 Score = 37.1 bits (82), Expect = 0.33 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 226 VTYVSLELFLFFLLMWSFIVFFLPKYFFPF 137 + YV L +F F + MW F+ F+ PKY FP+ Sbjct: 5 IYYVFLSIF-FIITMWYFLAFYSPKYLFPY 33 >UniRef50_A2DTE8 Cluster: Clan CA, family C2, calpain-like cysteine peptidase; n=1; Trichomonas vaginalis G3|Rep: Clan CA, family C2, calpain-like cysteine peptidase - Trichomonas vaginalis G3 Length = 1437 Score = 36.3 bits (80), Expect = 0.57 Identities = 23/75 (30%), Positives = 40/75 (53%) Frame = -2 Query: 233 FICNICIIGTFSFLFTNVVFYCLLFTKVFLSLHYFKSTSHGY*T*YLRVQQVYV*PKIYT 54 FIC I + + F F+++VF L+ T F ++F+S S G Q Y+ IYT Sbjct: 642 FICTIVVAASGIFYFSHIVFEVLIVTLCFALTYFFESKSFG-------AQASYIVTIIYT 694 Query: 53 LNIFESLNYDYESDD 9 + I ++++ ++S D Sbjct: 695 VAI--TISFIFKSKD 707 >UniRef50_A1Z398 Cluster: NADH-ubiquinone oxidoreductase chain 5; n=3; Romanomermis|Rep: NADH-ubiquinone oxidoreductase chain 5 - Romanomermis nielseni Length = 493 Score = 35.9 bits (79), Expect = 0.75 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = -2 Query: 257 FVSIEFSLFICNICIIGTFSFLFTNVVFYCLLFTKVFLSLHYFK 126 F+++E SL + N+ + + F+F N++ + +++ LS +YFK Sbjct: 31 FLNLEISLSLLNVIFMISLMFIFKNILKFSIIYMSKTLSFYYFK 74 >UniRef50_Q04WB4 Cluster: Peptidase, M50 family; n=4; Leptospira|Rep: Peptidase, M50 family - Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) Length = 308 Score = 34.7 bits (76), Expect = 1.7 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = -3 Query: 253 YRLNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYFFPFI 134 YR + +LF ++ L L+ F L+W F+++F+ K PF+ Sbjct: 212 YRNWIYYLFTAFLLLCLWNFSWLLWGFLIYFIIKVEHPFV 251 >UniRef50_Q557G7 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 57 Score = 33.9 bits (74), Expect = 3.0 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -3 Query: 202 FLFFLLMWSFIVFFLPKYFFPFIILSQQV 116 F FFLL + FI+FFL YFF F ++S V Sbjct: 12 FYFFLLFFVFILFFLFIYFFLFWVVSANV 40 >UniRef50_Q838Y3 Cluster: Membrane protein, putative; n=1; Enterococcus faecalis|Rep: Membrane protein, putative - Enterococcus faecalis (Streptococcus faecalis) Length = 456 Score = 33.1 bits (72), Expect = 5.3 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 247 LNLAFLFVTYVSLELFLFFLLMWSFI 170 L+L LF+ Y S+ LFLF LL++SFI Sbjct: 67 LSLPLLFIPYDSILLFLFLLLLFSFI 92 >UniRef50_Q9XMT1 Cluster: Orf365; n=5; Tetrahymena|Rep: Orf365 - Tetrahymena pyriformis Length = 365 Score = 33.1 bits (72), Expect = 5.3 Identities = 28/111 (25%), Positives = 46/111 (41%), Gaps = 1/111 (0%) Frame = -2 Query: 443 AIRIYFFVTISYYCVCWFTKTRHKLPVYILFLFAFRISXXXXXXXXXXXXXXXXXXXXXL 264 ++ + F +T + Y F + KL Y L+L++ I Sbjct: 73 SMMLLFLITFNGYSNT-FWWSHFKLNNYSLYLYSIIIIINNYFLYISDKHIKLNNNYSID 131 Query: 263 YIFVSIEFSLFICNICIIGT-FSFLFTNVVFYCLLFTKVFLSLHYFKSTSH 114 YIF I +LFI I + T F+F F + C +F K +S FK+ ++ Sbjct: 132 YIFSIINITLFIPMIFLANTLFTFFFIIELVSCSIFYKFIVSKISFKNNNY 182 >UniRef50_Q4Y399 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 83 Score = 33.1 bits (72), Expect = 5.3 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = -3 Query: 253 YRLNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYFFPF 137 Y L + FLF Y ++L+ +F L++ F +F+L +FF F Sbjct: 7 YHLMICFLFFVYHQVKLYYYFFLIF-FELFYLVYFFFFF 44 >UniRef50_UPI0001509C56 Cluster: hypothetical protein TTHERM_00647340; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00647340 - Tetrahymena thermophila SB210 Length = 224 Score = 32.7 bits (71), Expect = 7.0 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = -3 Query: 187 LMWSFIVFFLP--KYFFPFIILSQQVMGIK-HNISECNKCMYNQRFIHLIYSRVLTMTMN 17 ++ + I+ FLP +FF F++ + + K HN+ + NK + F +IYS + MN Sbjct: 77 IILTVIILFLPLINFFFYFLLWNSYFVYSKAHNVYKDNKAKVSNPFARMIYSSEICELMN 136 Query: 16 Q 14 + Sbjct: 137 K 137 >UniRef50_Q6LFI3 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1948 Score = 32.7 bits (71), Expect = 7.0 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 241 LAFLFVTYVSLELFLFFL-LMWSFIVFFLPKYFFPF 137 L FLF+ Y+ + LF++FL + +SF ++ YF P+ Sbjct: 1433 LIFLFIFYLFIYLFVYFLFIFYSFYIYIFIYYFKPW 1468 >UniRef50_A0NDS1 Cluster: ENSANGP00000030277; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000030277 - Anopheles gambiae str. PEST Length = 124 Score = 32.7 bits (71), Expect = 7.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 235 FLFVTYVSLELFLFFLLMWSFIVFFLPKYFFPFIILSQ 122 +LF+ Y ++L +FFL+++SFI Y F + I + Sbjct: 16 YLFIVYFFIDLLIFFLVIYSFIFNQFLTYLFIYFIFKK 53 >UniRef50_Q5AGI5 Cluster: Putative uncharacterized protein; n=2; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 191 Score = 32.7 bits (71), Expect = 7.0 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -3 Query: 253 YRLNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYFFPFIILSQQVM 113 + + F F+ ++ L LFLF +L + I+FFL FF I+ ++ Sbjct: 23 FLFTMVFRFLFFMILFLFLFMILFFLMILFFLMILFFLMILFFLMIL 69 >UniRef50_Q5A659 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 126 Score = 32.3 bits (70), Expect = 9.3 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 241 LAFL-FVTYVSLELFLFFLLMWSFIVFFLPKYFFPF 137 L+FL F++++S FLFFL SF+ FF +FF F Sbjct: 51 LSFLSFLSFLSFLSFLFFLSFLSFLSFFSFFFFFSF 86 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 426,846,430 Number of Sequences: 1657284 Number of extensions: 6575243 Number of successful extensions: 19774 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 18432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19565 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43562448615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -