BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0059 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0496 + 14706959-14707020,14707173-14707538,14708070-147082... 29 3.8 >05_03_0496 + 14706959-14707020,14707173-14707538,14708070-14708209, 14708319-14708566,14708814-14708946,14709096-14709159, 14709284-14709380,14709505-14709607,14709702-14709838, 14710063-14710152,14710240-14710401 Length = 533 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -3 Query: 250 RLNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYFFPFIILSQQVMGIKH 101 RL L +FV E + FF + F FF +FF F G +H Sbjct: 69 RLVLGAIFVLVGQWEGYAFFFFFFFFFFFFFFFFFFFFFFSGDVYCGHRH 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,946,988 Number of Sequences: 37544 Number of extensions: 162734 Number of successful extensions: 357 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -