BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0059 (609 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens ... 30 7.3 AF218028-1|AAG17270.1| 137|Homo sapiens unknown protein. 29 9.7 >AK128034-1|BAC87239.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ46153 fis, clone TESTI4001037. ). Length = 130 Score = 29.9 bits (64), Expect = 7.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -3 Query: 247 LNLAFLFVTYVSLELFLFFLLMWSFIVFFLPKYF--FPFIILS 125 L L+F F ++S F + SF+ FLP + FPF+ S Sbjct: 25 LFLSFFFFLFLSFSFSFFLFSLPSFLPSFLPSFLPSFPFLFFS 67 >AF218028-1|AAG17270.1| 137|Homo sapiens unknown protein. Length = 137 Score = 29.5 bits (63), Expect = 9.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 217 VSLELFLFFLLMWSFIVFFLPKYFFPFI 134 ++ FLFF L + +VFF+ YF+ F+ Sbjct: 13 ITFNFFLFFFLPFPLVVFFIYFYFYFFL 40 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,405,898 Number of Sequences: 237096 Number of extensions: 1029770 Number of successful extensions: 5715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5715 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -