BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0044 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 25 2.3 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 9.4 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 567 HCTTHVCNVLYQLEAPQFVRLDGIGAVNEPLAPGFVMLCARYST 698 H N+LY+L+ P+F LD N ++P LC +T Sbjct: 102 HSDCKAMNLLYKLKDPEFASLD-----NRRISPLRAWLCEHANT 140 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.0 bits (47), Expect = 9.4 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 462 HRIPDNHQR-FHSDNHKTHYCFVT*DHDHITY 554 H+ HQ+ +HS H T F T HD+ Y Sbjct: 316 HQPQQQHQQQYHSHPHHTPVQFKTELHDNTQY 347 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,960 Number of Sequences: 2352 Number of extensions: 14693 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -