BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0044 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.92 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 4.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.9 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 6.5 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 22 6.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 6.5 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 21 8.6 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 0.92 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 372 IVRTPGGRLVYQYVKKPKKI 313 + + G RLVYQ+V PK I Sbjct: 527 LAKVDGQRLVYQFVDVPKDI 546 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 53 YLNLSPKIHFVAFFAD 100 Y + P IHF FAD Sbjct: 454 YFFICPSIHFAQLFAD 469 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 53 YLNLSPKIHFVAFFAD 100 Y + P IHF FAD Sbjct: 454 YFFICPSIHFAQLFAD 469 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 VHLRHRYRQDEQTEALLIDKGHYKH 580 VH+ H YRQ + GH H Sbjct: 21 VHVYHPYRQPDGMNQCQAVNGHCSH 45 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 VHLRHRYRQDEQTEALLIDKGHYKH 580 VH+ H YRQ + GH H Sbjct: 21 VHVYHPYRQPDGMNQCQAVNGHCSH 45 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 325 LFDILINQAATRCPY 369 LFD+ N++ +CPY Sbjct: 550 LFDLDYNESEEQCPY 564 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 602 LIKDITNMSGTVILKLISDVIVVLGNEAIMCFV 504 LI D + +I+KL+ +I+ IMC + Sbjct: 263 LIVDFFMILNEIIMKLVGIIIMWYSPFGIMCLI 295 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.4 bits (43), Expect = 8.6 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +2 Query: 530 LRPRSHHLLVLISLYHSC 583 ++P+ H+ + S+YH C Sbjct: 29 IKPKDHNGSIYWSMYHLC 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,707 Number of Sequences: 438 Number of extensions: 3863 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -