BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0022 (357 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 28 0.025 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 0.94 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 2.9 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 20 6.6 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 8.7 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 28.3 bits (60), Expect = 0.025 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 173 GTTGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMT 304 G + + TL V F +WY+ S++++ VG A T + P T + Sbjct: 235 GGASASKVTLSVPFYGHSWYLQSTSNHDVGAPATTGIAGPFTQS 278 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.0 bits (47), Expect = 0.94 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 320 HTAVPLS*LVEMVALLMPVCP--RHYWLNLTYTTLRTG 213 H + LS ++ VA V RHY++N+T+ L G Sbjct: 475 HLLMELSRAIDSVACSKTVSDGIRHYYVNVTFPHLFNG 512 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 2.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 7 YNII*ASLITKNVYVTQN 60 YNI+ SL VY+T N Sbjct: 47 YNIVAVSLTAYMVYITTN 64 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 20.2 bits (40), Expect = 6.6 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 165 LFFLSESTLKQSCYHRITEDL*FNNSLLFRTIHEI--ILCNIYIF 37 L +S +T K CYH I NN T+ +I LC I+ Sbjct: 12 LGIVSAATNKVVCYHGIWSTYRLNNGKF--TVEDIDPTLCTHLIY 54 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 19.8 bits (39), Expect = 8.7 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 253 CRGQTGINRATISTNYDSGTAVCS 324 C G TG RAT +S V S Sbjct: 922 CAGSTGTRRATGCGRVESVAEVTS 945 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,223 Number of Sequences: 336 Number of extensions: 1726 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7193380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -