BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0022 (357 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 1.1 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 23 4.5 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 158 KKSAMGTTGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLT 298 K ++G +GSR+ +V +WY+ + + V L + + P T Sbjct: 636 KNVSIGRSGSRKLIEVVPDTTTSWYLTGFSIDPVYGLGIIKKPIQFT 682 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 22.6 bits (46), Expect = 4.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 143 VLSDKKKSAMGTTGSRRETLIVGFLCAAWYMLSSASNVVGKLA 271 +LSD +S G +R+ L V Y+L + VVG ++ Sbjct: 23 ILSDGVESLTEMYGPKRDPLYVVIPITIIYLLIFITGVVGNIS 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 369,939 Number of Sequences: 2352 Number of extensions: 6570 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -