BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0022 (357 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01550.1 68416.m00085 triose phosphate/phosphate translocator... 34 0.024 At5g33320.1 68418.m03955 triose phosphate/phosphate translocator... 34 0.032 At5g17630.1 68418.m02067 glucose-6-phosphate/phosphate transloca... 30 0.52 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate transloca... 28 1.6 At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator... 28 1.6 At5g05560.1 68418.m00604 E3 ubiquitin ligase, putative E3, ubiqu... 28 2.1 At4g21630.1 68417.m03135 subtilase family protein contains simil... 27 2.8 At1g61800.1 68414.m06969 glucose-6-phosphate/phosphate transloca... 27 2.8 At3g28250.1 68416.m03528 glycosyl hydrolase family protein 17 si... 27 3.7 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 27 3.7 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 27 3.7 At4g03190.1 68417.m00436 F-box family protein (FBL18) almost ide... 27 4.9 At3g22104.1 68416.m02789 phototropic-responsive NPH3 protein-rel... 27 4.9 At1g32950.1 68414.m04058 subtilase family protein contains simil... 27 4.9 At1g15780.1 68414.m01893 expressed protein 27 4.9 At4g21640.1 68417.m03136 subtilase family protein similar to sub... 26 6.4 At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containi... 26 8.5 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 26 8.5 At1g51800.1 68414.m05837 leucine-rich repeat protein kinase, put... 26 8.5 >At3g01550.1 68416.m00085 triose phosphate/phosphate translocator, putative similar to SWISS-PROT:P52178 triose phosphate/phosphate translocator [Cauliflower]{Brassica oleracea} Length = 383 Score = 34.3 bits (75), Expect = 0.024 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 179 TGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMTAVQ 313 +GS + L +G + WY+L+ N+ K L P+P T+TA Q Sbjct: 70 SGSLVKGLKLGGMFGVWYLLNIYYNIFNKQVLRVYPYPATVTAFQ 114 >At5g33320.1 68418.m03955 triose phosphate/phosphate translocator, putative similar to SWISS-PROT:P52178 triose phosphate/phosphate translocator [Cauliflower] {Brassica oleracea} Length = 408 Score = 33.9 bits (74), Expect = 0.032 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 179 TGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMTAVQ 313 +G + L +G L A WY+ + N+ K L L P+T+T VQ Sbjct: 99 SGKLTKVLELGLLFAMWYLFNIYFNIYNKQVLKALHAPMTVTLVQ 143 >At5g17630.1 68418.m02067 glucose-6-phosphate/phosphate translocator, putative similar to glucose-6-phosphate/phosphate-translocator precursor [Solanum tuberosum] gi|2997593|gb|AAC08526 Length = 417 Score = 29.9 bits (64), Expect = 0.52 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 188 RRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMTAVQ 313 + +TL +G + WY + N+ K AL P+P + + Q Sbjct: 106 KAKTLQLGIVFGLWYFQNIVFNIFNKKALNVFPYPWLLASFQ 147 >At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identical to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 Length = 388 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 164 SAMGTTGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFP-LTMT 304 +A T + L +G A W+ L+ N+ K L P+P LT T Sbjct: 83 AAAETKSEAAKKLKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTST 130 >At5g46110.1 68418.m05669 phosphate/triose-phosphate translocator, putative identical to phosphate/triose-phosphate translocator precursor [Arabidopsis thaliana] gi|3983125|gb|AAC83815; similar to triose phosphate/phosphate translocator, chloroplast precursor (CTPT)[Cauliflower]{Brassica oleracea} SWISS-PROT:P52177 Length = 410 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 200 LIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMTAV 310 L+ GF WY L+ N++ K P+P ++ + Sbjct: 106 LVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVI 142 >At5g05560.1 68418.m00604 E3 ubiquitin ligase, putative E3, ubiquitin ligase; contains similarity to Apc1/Tsg24 protein, the largest subunit of human anaphase-promoting complex (APC/C) GI:11967711 from [Homo sapiens] Length = 1678 Score = 27.9 bits (59), Expect = 2.1 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 14/96 (14%) Frame = -1 Query: 252 LLAELNIYHAAHRKPTISVSRL--EPVVPIALFFLSESTLKQS---------CYHRITED 106 L+++ + ++ S++RL E +VP SE TL S C H + E Sbjct: 533 LISKFHKTYSRFHNGITSINRLDLEGIVPFDSKICSEETLGSSCELMVQSLDCLHAVYES 592 Query: 105 L*FNNSLLFRTIHE--IILCNIYIFGNQAC-LNYIV 7 L +N L + +H ++LCNI F ++ C L+Y + Sbjct: 593 LKMDN-LRKQDLHHLAVLLCNIAKFLDEKCYLDYYI 627 >At4g21630.1 68417.m03135 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 772 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 206 VGFLCAAWYMLSSASNVVGKLALTELPFP 292 + ++C+A Y+ SS S V+GK +P P Sbjct: 638 INYMCSAGYIDSSISRVLGKKTKCTIPKP 666 >At1g61800.1 68414.m06969 glucose-6-phosphate/phosphate translocator, putative similar to glucose-6-phosphate/phosphate-translocator precursor GI:2997591 from [Pisum sativum] Length = 388 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 194 ETLIVGFLCAAWYMLSSASNVVGKLALTELPFP-LTMT 304 + L +G A W+ L+ N+ K L P+P LT T Sbjct: 93 QKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTST 130 >At3g28250.1 68416.m03528 glycosyl hydrolase family protein 17 similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 121 Score = 27.1 bits (57), Expect = 3.7 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -2 Query: 131 VAITESLKIFNSIIHYYSVQYTR*FCVTYTFLVIRLA 21 VAIT+ + + S++ +Y++ Y FC+ + R A Sbjct: 73 VAITDPSEFYLSLLFHYTIIYVLFFCLISNYFCFRQA 109 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 27.1 bits (57), Expect = 3.7 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +1 Query: 157 KKKRNGYNRLQARDTNSWLPV 219 +KK+ G+ +L+ +TNS+LP+ Sbjct: 35 EKKKKGFGKLRHGETNSFLPI 55 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 27.1 bits (57), Expect = 3.7 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +1 Query: 157 KKKRNGYNRLQARDTNSWLPV 219 +KK+ G+ +L+ +TNS+LP+ Sbjct: 34 EKKKKGFGKLRHGETNSFLPI 54 >At4g03190.1 68417.m00436 F-box family protein (FBL18) almost identical to GRR1-like protein 1 GI:12658970 from [Arabidopsis thaliana]; similar to leucine-rich repeats containing F-box protein FBL3 (GI:5919219) [Homo sapiens]; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 585 Score = 26.6 bits (56), Expect = 4.9 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -2 Query: 296 LVEMVALLMPVCPRHYWLNLTYTTLRTGSQLLVSRAWSRLYPL 168 L E + L VCP LNL+Y T+R + + R S+L L Sbjct: 273 LPEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKL 315 >At3g22104.1 68416.m02789 phototropic-responsive NPH3 protein-related contains BTB/POZ domain, INTERPRO:IPR000210 Length = 506 Score = 26.6 bits (56), Expect = 4.9 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = -2 Query: 209 QLLVSRAWSRLYPLRF-FFYQKVL*SKVAITESLKIFNSIIHYYSVQYTR*FCVTYTFLV 33 +L+V R + L RF F+YQKV + E KI +II V F V Sbjct: 206 KLMVLRKFDNLIISRFLFYYQKVKFCSASSHEKRKILETIIDTLCVLDRSCVPCKSLFAV 265 Query: 32 IRLA 21 +RLA Sbjct: 266 LRLA 269 >At1g32950.1 68414.m04058 subtilase family protein contains similarity to SBT1 GI:1771160 from [Lycopersicon esculentum] Length = 773 Score = 26.6 bits (56), Expect = 4.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 212 FLCAAWYMLSSASNVVGKLALTELPFP 292 +LC+A Y SS S +VGK+ + P P Sbjct: 636 YLCSAGYNDSSISRLVGKVTVCSNPKP 662 >At1g15780.1 68414.m01893 expressed protein Length = 1335 Score = 26.6 bits (56), Expect = 4.9 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +2 Query: 167 AMGTTGSRRETLIVGFLCAAWYMLSSASNVVGKLALTELPFPLTMTAVQ 313 A+GT G L+ F +L+S++ GK + TELP + AV+ Sbjct: 1007 AIGTPGISASPLLQEFTSPDGNILNSSTITSGKPSATELPIERLIRAVK 1055 >At4g21640.1 68417.m03136 subtilase family protein similar to subtilase SP1 [Oryza sativa] GI:9957714 Length = 733 Score = 26.2 bits (55), Expect = 6.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 206 VGFLCAAWYMLSSASNVVGKLALTELPFP 292 + ++C+A Y SS S V+GK +P P Sbjct: 599 INYMCSAGYNDSSISRVLGKKTKCPIPKP 627 >At5g19020.1 68418.m02260 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 939 Score = 25.8 bits (54), Expect = 8.5 Identities = 16/61 (26%), Positives = 34/61 (55%) Frame = -1 Query: 303 VIVSGNGSSVNASLPTTLLAELNIYHAAHRKPTISVSRLEPVVPIALFFLSESTLKQSCY 124 ++V +G+ + +S + L+ L++ + TIS+S L P P+ +FF S+ + + + Sbjct: 57 ILVLFSGTFLLSSYFSYLIHSLSLLSSHFPSITISLSSLLP--PLIIFFSSDHSTEDEDH 114 Query: 123 H 121 H Sbjct: 115 H 115 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 213 KPTISVSRLEPVVPIALFFLSESTLKQSCYHRIT 112 KP+ S S L+P AL L+ T+K C HR T Sbjct: 40 KPSSSSSPLDPKQLKALESLNIPTVKDPCNHRPT 73 >At1g51800.1 68414.m05837 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 894 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -1 Query: 342 GTLSEAAAHSCTAVIVSGNGSSVNASLPTTLL 247 G++ E A+ T +++ +G+ +N S+P TLL Sbjct: 446 GSVPEFLANMETLKLINLSGNELNGSIPATLL 477 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,248,638 Number of Sequences: 28952 Number of extensions: 130204 Number of successful extensions: 313 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 459356736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -