BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0007 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 26 0.70 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 1.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 6.5 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 26.2 bits (55), Expect = 0.70 Identities = 13/55 (23%), Positives = 23/55 (41%) Frame = +1 Query: 178 LAYIHSQQLVHMDVKPGNIFICSGDVDACRESDDGYDDEEPAPNHKYKIGDLGHV 342 L Y H ++H DV+P + + D ++ G+ PN + + G V Sbjct: 108 LRYCHENDIIHRDVRPACALLATAD-NSAPVKLGGFGSAVQLPNGRDSVETHGRV 161 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.4 bits (53), Expect = 1.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 175 GLAYIHSQQLVHMDVKPGNIFI 240 G+AY+ ++LVH D+ N+ + Sbjct: 946 GMAYLEERRLVHRDLAARNVLV 967 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 418 TITGTENYQICQTCPESSMISSRAW 492 T G ++ CP+ SM+ R W Sbjct: 617 TTDGPVTRRVSAGCPQGSMLGPRLW 641 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,909 Number of Sequences: 2352 Number of extensions: 9667 Number of successful extensions: 54 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -