BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0004 (537 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 24 0.74 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 6.9 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 24.2 bits (50), Expect = 0.74 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +1 Query: 94 KNKLC*FLSICVPLDTFTGTFR*NLAIKSEEIPLCESSTLVDTSDVYETSEPVS 255 KN +C LS+ + D + +L + E C+++T+ + ++YE S VS Sbjct: 262 KNFVC-LLSLIILCDCVVKEAQKSLVLTYEMRWYCQTATMEEKQELYEFSNFVS 314 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/41 (21%), Positives = 22/41 (53%) Frame = -2 Query: 251 TGSDVSYTSEVSTNVLLSQRGISSDLMAKFHLNVPVNVSRG 129 T + ++Y TN+ + +G ++++ F +++SRG Sbjct: 421 TVAQLNYPGVTVTNIEVQAKGGKPNVLSTFWQQSDLDLSRG 461 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,017 Number of Sequences: 336 Number of extensions: 2387 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -