BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0004 (537 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L22531-1|AAA28598.1| 294|Drosophila melanogaster gurken protein. 28 9.3 AY051814-1|AAK93238.1| 295|Drosophila melanogaster LD32255p pro... 28 9.3 AF223394-1|AAF72000.1| 294|Drosophila melanogaster gurken protein. 28 9.3 AE014134-1509|AAF52675.4| 295|Drosophila melanogaster CG17610-P... 28 9.3 >L22531-1|AAA28598.1| 294|Drosophila melanogaster gurken protein. Length = 294 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +1 Query: 199 ESSTLVDTSDVYETSEPVSVVGRVPASGCASGDIMWLLNEPNQPYEDCEQLLCFRYYN 372 ESST + S+ T E V+ G P +S PN + + L C YN Sbjct: 130 ESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYN 187 >AY051814-1|AAK93238.1| 295|Drosophila melanogaster LD32255p protein. Length = 295 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +1 Query: 199 ESSTLVDTSDVYETSEPVSVVGRVPASGCASGDIMWLLNEPNQPYEDCEQLLCFRYYN 372 ESST + S+ T E V+ G P +S PN + + L C YN Sbjct: 131 ESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYN 188 >AF223394-1|AAF72000.1| 294|Drosophila melanogaster gurken protein. Length = 294 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +1 Query: 199 ESSTLVDTSDVYETSEPVSVVGRVPASGCASGDIMWLLNEPNQPYEDCEQLLCFRYYN 372 ESST + S+ T E V+ G P +S PN + + L C YN Sbjct: 130 ESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYN 187 >AE014134-1509|AAF52675.4| 295|Drosophila melanogaster CG17610-PA protein. Length = 295 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +1 Query: 199 ESSTLVDTSDVYETSEPVSVVGRVPASGCASGDIMWLLNEPNQPYEDCEQLLCFRYYN 372 ESST + S+ T E V+ G P +S PN + + L C YN Sbjct: 131 ESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYN 188 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,798,112 Number of Sequences: 53049 Number of extensions: 464745 Number of successful extensions: 1310 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1310 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -