BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120960.seq (633 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118911-1|AAM50771.1| 356|Drosophila melanogaster LD21610p pro... 30 3.0 AE014134-1201|AAF52466.1| 356|Drosophila melanogaster CG9200-PA... 30 3.0 >AY118911-1|AAM50771.1| 356|Drosophila melanogaster LD21610p protein. Length = 356 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = -1 Query: 381 DLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGGRSQNLNYLF 244 DLP + DE GG P A T N R GRS+N N L+ Sbjct: 90 DLPTLSPNDEEGGTNETPTDASSWTQEANKNRDRSNGRSENFNRLW 135 >AE014134-1201|AAF52466.1| 356|Drosophila melanogaster CG9200-PA protein. Length = 356 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = -1 Query: 381 DLPLCAILDESGG*TVHPVPAPFSTILLEINNIREGGRSQNLNYLF 244 DLP + DE GG P A T N R GRS+N N L+ Sbjct: 90 DLPTLSPNDEEGGTNETPTDASSWTQEANKNRDRSNGRSENFNRLW 135 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,157,186 Number of Sequences: 53049 Number of extensions: 336209 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2641708800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -