BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120959.seq (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.46 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.46 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 23 3.2 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.4 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.4 bits (53), Expect = 0.46 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 228 KFNSLYI*FICFNLGILFFLCLTSLGVYIVIIAGWSSNSNYALL 359 K L+I +CF ++ C+T G+Y+ + + S + LL Sbjct: 413 KRKELFIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLL 456 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.4 bits (53), Expect = 0.46 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 228 KFNSLYI*FICFNLGILFFLCLTSLGVYIVIIAGWSSNSNYALL 359 K L+I +CF ++ C+T G+Y+ + + S + LL Sbjct: 466 KRKELFIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLL 509 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -1 Query: 331 QPAIITI*TPKLVKHKKNKIPKLKQ 257 +P I+ T K ++H+ ++ KLK+ Sbjct: 8 RPTIVKKRTKKFIRHQSDRYSKLKR 32 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 312 IVIIAGWSSNSNYALLGGLRSVAQTIS 392 ++ + W+S N + L +V QTIS Sbjct: 16 MIHLIAWASLENTGISDRLENVTQTIS 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,792 Number of Sequences: 438 Number of extensions: 1518 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -