BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120957.seq (483 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 25 0.56 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 5.2 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.6 bits (51), Expect = 0.56 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 190 KNANIHQNIDGQNHYRRNGTRR 255 +NAN +QN D QN ++NG R+ Sbjct: 440 QNAN-NQNADNQNANKQNGNRQ 460 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 5.2 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = +1 Query: 193 NANIHQNIDGQNHYRRNGTRRTVADLKQKIADKEGVPVDQQRLIFAG 333 N IH N + + +Y N L I E +PV I+ G Sbjct: 87 NRTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPVPVPVPIYCG 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,919 Number of Sequences: 438 Number of extensions: 3059 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -