BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120953.seq (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 31 0.77 SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) 27 9.4 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 31.1 bits (67), Expect = 0.77 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 394 CKHQLCSMCXXXXXXXXXXPCPLCRV 471 C+H+ C MC CP+CR+ Sbjct: 52 CEHEFCKMCFTQNVQEANLQCPMCRI 77 >SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 301 CNICFSVAEIK-NYFMQPIDRLTIIPVLELDTCKHQLC 411 C ++ +K F QP RL+ IPV+E C H +C Sbjct: 33 CQFVYASVLLKFTNFTQPCPRLSGIPVVEASVCHHIIC 70 >SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +1 Query: 100 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFS 249 RR C FW + K L C+T +Q TL+ A A W+++ +VLFS Sbjct: 524 RRARECIFWPGMPAEIKQLASVCDACQTFAKAQQKETLIAIEAKAPWEIVGVVLFS 579 >SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) Length = 637 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +1 Query: 100 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFS 249 RR C FW + K L C+T +Q +TL+ A A W+++ + LFS Sbjct: 450 RRARECIFWPGMSAEIKQLASVCDACQTFAKAQQKKTLITIEAKAPWEIVGVDLFS 505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,212,657 Number of Sequences: 59808 Number of extensions: 338234 Number of successful extensions: 752 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -