BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120953.seq (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12270.1 68417.m01944 copper amine oxidase family protein con... 30 1.4 At3g27330.1 68416.m03418 zinc finger (C3HC4-type RING finger) fa... 29 2.5 At4g12290.1 68417.m01947 copper amine oxidase, putative similar ... 28 5.8 At3g28620.1 68416.m03572 zinc finger (C3HC4-type RING finger) fa... 28 5.8 >At4g12270.1 68417.m01944 copper amine oxidase family protein contains similarity to copper amine oxidase [Cicer arietinum] gi|3819099|emb|CAA08855; contains Pfam domains PF02728: Copper amine oxidase, N3 domain and PF02727: Copper amine oxidase, N2 domain Length = 460 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 310 CFSVAEIKNYFMQPIDRLTIIPVLELDT 393 CFS + N++M+PI+ LT++ +LDT Sbjct: 236 CFSTQDTPNFYMRPIEGLTLL--FDLDT 261 >At3g27330.1 68416.m03418 zinc finger (C3HC4-type RING finger) family protein contains Pfam profiles: PF00097 zinc finger, C3HC4 type (RING finger), PF01697 Domain of unknown function Length = 913 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/42 (28%), Positives = 15/42 (35%) Frame = +1 Query: 391 TCKHQLCSMCXXXXXXXXXXPCPLCRVESLHFNVYSINRTLW 516 TC H C C CP CR + ++N LW Sbjct: 738 TCGHSFCKKCLRSAADKCGRKCPKCRQLIGNGRYCTVNTVLW 779 >At4g12290.1 68417.m01947 copper amine oxidase, putative similar to copper amine oxidase [Cicer arietinum] gi|3819099|emb|CAA08855 Length = 566 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 310 CFSVAEIKNYFMQPIDRLTIIPVLELDT 393 CF N++M+PI+ LTI+ ++LDT Sbjct: 58 CFMTQGTPNFYMRPIEGLTIL--IDLDT 83 >At3g28620.1 68416.m03572 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 finger protein RHA2b [Arabidopsis thaliana] GI:3790571; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 211 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 382 ELDTCKHQLCSMCXXXXXXXXXXPCPLCR--VESLH 483 E+ TC H C CPLCR V+ LH Sbjct: 175 EMPTCSHYFHEPCLTEWLTRDNNSCPLCRKPVDKLH 210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,496,772 Number of Sequences: 28952 Number of extensions: 231633 Number of successful extensions: 526 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -