BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120951.seq (641 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q02785 Cluster: ATP-dependent permease PDR12; n=5; Sacc... 33 7.7 >UniRef50_Q02785 Cluster: ATP-dependent permease PDR12; n=5; Saccharomycetales|Rep: ATP-dependent permease PDR12 - Saccharomyces cerevisiae (Baker's yeast) Length = 1511 Score = 32.7 bits (71), Expect = 7.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 599 STICSFLHIFTK*CRCFTSAQASRDGSFFFLVAIFFPQLYITY 471 ST+C F+ S +AS G FFF + FP ++TY Sbjct: 1266 STLCQFMCFICYYWPAQFSGRASHAGFFFFFYVLIFPLYFVTY 1308 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,250,875 Number of Sequences: 1657284 Number of extensions: 11341453 Number of successful extensions: 22640 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22639 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -