BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120950.seq (625 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U4Y5 Cluster: Hitcher protein; n=1; Manduca sexta|Rep... 86 6e-16 UniRef50_A4J318 Cluster: Peptidase M23B precursor; n=2; cellular... 33 7.3 >UniRef50_Q9U4Y5 Cluster: Hitcher protein; n=1; Manduca sexta|Rep: Hitcher protein - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 291 Score = 86.2 bits (204), Expect = 6e-16 Identities = 42/66 (63%), Positives = 46/66 (69%) Frame = +1 Query: 31 SSLKPETPRLLEYIDSNSDSSDTATCDLDSRTLPLTPLNFILSDDDHTVCDSSDLQYDSF 210 S+ T RL EYIDSNSDSSDT + LT LN I D+DHT+CDSSDLQYDSF Sbjct: 226 STAGTSTSRLYEYIDSNSDSSDTTVTHDADNIVHLTSLNMISPDEDHTLCDSSDLQYDSF 285 Query: 211 VDMGKF 228 VDMGKF Sbjct: 286 VDMGKF 291 >UniRef50_A4J318 Cluster: Peptidase M23B precursor; n=2; cellular organisms|Rep: Peptidase M23B precursor - Desulfotomaculum reducens MI-1 Length = 598 Score = 32.7 bits (71), Expect = 7.3 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 227 NFPISTKESYCKSELSHTVWSSSDKMKLRGV 135 N P S+ + +C++E + +W ++K LRGV Sbjct: 430 NKPYSSTQEWCRAEYASIIWGFAEKFNLRGV 460 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,306,744 Number of Sequences: 1657284 Number of extensions: 10327435 Number of successful extensions: 24156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24127 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 45636850930 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -