Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120950.seq
         (625 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB037830-1|BAA92647.2| 2461|Homo sapiens KIAA1409 protein protein.     31   4.4  

>AB037830-1|BAA92647.2| 2461|Homo sapiens KIAA1409 protein protein.
          Length = 2461

 Score = 30.7 bits (66), Expect = 4.4
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 8/63 (12%)
 Frame = +1

Query: 28   DSSLKPETPRLLEYIDSNSDS-------SDTATCDLDSRTL-PLTPLNFILSDDDHTVCD 183
            DS +KP     L+ ID +SDS       S  +T D DS    PL PL  + SD++    +
Sbjct: 1420 DSPVKPAPKEDLDLIDLSSDSTSGPEKHSILSTSDSDSLVFEPLPPLRIVESDEEEETMN 1479

Query: 184  SSD 192
              D
Sbjct: 1480 QGD 1482


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,321,409
Number of Sequences: 237096
Number of extensions: 1633975
Number of successful extensions: 2809
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2809
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6747805200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)