BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV120949.seq
(637 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A0LY26 Cluster: Protein containing DUF323; n=10; Bacter... 33 7.6
>UniRef50_A0LY26 Cluster: Protein containing DUF323; n=10;
Bacteroidetes|Rep: Protein containing DUF323 - Gramella
forsetii (strain KT0803)
Length = 387
Score = 32.7 bits (71), Expect = 7.6
Identities = 19/68 (27%), Positives = 28/68 (41%), Gaps = 2/68 (2%)
Frame = +3
Query: 438 RWYATPVTMSLPSFVVNLYLFGKYIYSN*RT--LNSYLNPVGVKMTWVNRNSLGCMXKAW 611
+W+ T FV+ Y+ +Y NSY VG K+ NR +L AW
Sbjct: 42 KWHLGHTTWFFEEFVLKKYVDTHKLYDENTAYVFNSYYESVGEKVIRTNRGNLSRPTVAW 101
Query: 612 VLKIEWYL 635
+ K Y+
Sbjct: 102 IYKFRKYV 109
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 479,774,617
Number of Sequences: 1657284
Number of extensions: 7174188
Number of successful extensions: 13537
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13095
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13532
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -