BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120945.seq (617 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1163 - 31398565-31398654,31398729-31398812,31398893-313990... 29 3.9 09_02_0393 + 8510089-8510274,8510450-8510806,8510889-8511011,851... 27 9.0 >04_04_1163 - 31398565-31398654,31398729-31398812,31398893-31399037, 31399118-31399239,31399338-31399376,31399491-31399601, 31399682-31399804,31399946-31400032,31400136-31400207, 31400349-31400621,31400704-31400895,31400988-31401171, 31401339-31401480,31401578-31401821,31401959-31402603, 31403024-31403293 Length = 940 Score = 28.7 bits (61), Expect = 3.9 Identities = 26/72 (36%), Positives = 30/72 (41%) Frame = -2 Query: 592 HRPTSNTRTLLPSGKILFSIPPYELNELQF*LHTYHACDCEKLKMIIQFNEWA*CEFFNV 413 HR N L+ G SIPPY L H+ E L II A C N+ Sbjct: 317 HRVNCNQTALVLGGGASASIPPYSLFASPGASVPLHSEIVEHLASII---APALCP-SNI 372 Query: 412 LDSVKVSVYLYG 377 L VK S +LYG Sbjct: 373 LPKVKFSTFLYG 384 >09_02_0393 + 8510089-8510274,8510450-8510806,8510889-8511011, 8511209-8511523,8511576-8511682,8512559-8512629, 8512952-8513029,8513390-8513454,8514224-8514274, 8514373-8514414,8514785-8515105,8515154-8517880 Length = 1480 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -2 Query: 340 CSNCIQNWLKFYARENVKKLALSTQVSTAET--KTRLITGSYKSIKVFIVR 194 C++ + + L+ Y RE+ KKL +S+ + T K RL Y++ K VR Sbjct: 613 CTSSLLDPLEVYGREDEKKLIISSLLDGCLTFKKRRLKEHEYETCKAGAVR 663 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,274,248 Number of Sequences: 37544 Number of extensions: 253058 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -