BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120924.seq (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 27 0.14 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 2.9 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 6.8 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.0 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 27.1 bits (57), Expect = 0.14 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 314 TDMYLYKEQNETITNFVKKIL-DISGPDLGCRKLMRIYLNTDTFSGQLPAY 463 T+M L K+ +E F KIL + G + G K MR T P+Y Sbjct: 88 TEMLLKKDSSEAFNEFRTKILAQVHGTNNGTNKNMRRLSTTTQNKNDDPSY 138 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 304 DTRIVRFRRQVGKQ 263 DTR VR R +VGK+ Sbjct: 8 DTRTVRLRNRVGKR 21 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 177 NDQLMCLLKDIFTNKFDYKIKRRLNH 254 ND+++ +L+DI+++ D L H Sbjct: 342 NDEVLQVLEDIYSDLLDLTDNNELFH 367 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 419 IYLNTDTFSGQLPAYLTHYVN 481 ++ + FSG+LP +L + N Sbjct: 462 VFAVINVFSGELPVFLQEHRN 482 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +2 Query: 419 IYLNTDTFSGQLPAYLTHYVN 481 ++ + FSG+LP +L + N Sbjct: 462 VFAVINVFSGELPVFLQEHRN 482 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,854 Number of Sequences: 336 Number of extensions: 3329 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -