BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120924.seq (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_20450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.9 SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) 28 5.9 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 84 KRPFNADRCIKNFSLLGNE-YHVLVSSLQRVLN 179 +RPF DRC K F G+ H+ SS R LN Sbjct: 563 ERPFECDRCDKRFGRSGDRARHIRKSSRIRTLN 595 >SB_20450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +3 Query: 87 RPFNADRCIKNFSLLGNEYHVLVSSLQRVLNDQLMCLLKDIF---TNKFDYKIKRRLNHS 257 R D IKN + +EY++LV ++ D + IF + F+YK +NH+ Sbjct: 466 RDIRHDVIIKNIEQIISEYYILVLDMRDAFPDMDLANFAKIFQFAPSIFEYKC---INHN 522 Query: 258 SACLPTCRR 284 + CRR Sbjct: 523 TISKHFCRR 531 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 15 DNCVKITTAPLSFNVFFVNVRIMKRPFNADRCIKNF 122 + C K P+S N V ++RP+ D+C K F Sbjct: 506 NECEKKFKHPVSLNKHVRGVHSLERPYKCDQCDKKF 541 >SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) Length = 646 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 35 HSPAVFQRVFCQRAHYETTLQRGPLHQKF 121 HSP + +++ HY +QR P H+ F Sbjct: 505 HSPRIPPKIYAGFVHYRAFIQRDPSHRWF 533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,766,949 Number of Sequences: 59808 Number of extensions: 405353 Number of successful extensions: 974 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -