BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120922.seq (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 25 1.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 6.3 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 25.4 bits (53), Expect = 1.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 383 KECDRLMKKGFLLKAAFRVRTCDYSIQRQHAKAPLK 276 +EC + + G L K AFRV + D+S+ AK +K Sbjct: 61 REC--VKETGILPKNAFRVLSGDFSVDTMKAKCFVK 94 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 479 KSCDCVVVRCKRWTPYFLT-IYIYSCAHERLPLKE 378 ++CD + R TPY+ T +Y ER L+E Sbjct: 286 RACDVAMERVSSSTPYYQTKPQVYWWTPERAQLRE 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,513 Number of Sequences: 2352 Number of extensions: 11384 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -