BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120922.seq (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024831-10|AAK72074.2| 521|Caenorhabditis elegans Hypothetical... 31 0.71 Z50874-10|CAA90770.1| 302|Caenorhabditis elegans Hypothetical p... 29 3.8 >AC024831-10|AAK72074.2| 521|Caenorhabditis elegans Hypothetical protein Y55F3C.3a protein. Length = 521 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 361 FIRRSHSFSGSRSWAQLYIYIVKKYGVQRLHRTTTQSHDFKYTGRLNY-ESLCF 519 F+R +H R WA Y +Y +R+ R +DF TG+L+ + LCF Sbjct: 96 FVRMNHEHR--RQWADWYFEEQDEYFFERVPRYFDPIYDFYATGKLHVPKDLCF 147 >Z50874-10|CAA90770.1| 302|Caenorhabditis elegans Hypothetical protein R10E4.11 protein. Length = 302 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 569 VKIFRIRVEHVVNHEGKKHRLS*LRRPVYLKSCDCVVV 456 V+ FR V+ V+ HE +KH LR+ + K +C VV Sbjct: 231 VRQFRT-VKEVIEHEKEKHLAKPLRKTQFFKCNECSVV 267 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,083,971 Number of Sequences: 27780 Number of extensions: 254318 Number of successful extensions: 526 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -